Lsi07G008950 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGCAAGCGGGAGCATATTCCGGCGTGATGTACTGGAAGACAGGGCCGCACTCACTGCCTTTGGCGAGGATAAAGAAGATCATGAAGAAATCCGGAGAGGAGGTGAAGATGATCTCCGGCGAGGCTCCGATCGTTTTCTCGAAGGCGTGTGAACTGTTCATCGAAGAATTGACGAGGAGATCGTGGATGATTGCGATGCAGAGCAAGAAGAGGATGCTTCACAAAGAGGATGTGGCTTCCGCCATTTTGGCCACTGATGTTTTCGATTTTCTGATCGGATTGATCTTCAATGAAACCGCCGCCACCGCCTCCGCCGCCGGAAACCTTGCTGAAAGTGAAACTATGTCGATACCTTTCTGA ATGAGGCAAGCGGGAGCATATTCCGGCGTGATGTACTGGAAGACAGGGCCGCACTCACTGCCTTTGGCGAGGATAAAGAAGATCATGAAGAAATCCGGAGAGGAGGTGAAGATGATCTCCGGCGAGGCTCCGATCGTTTTCTCGAAGGCGTGTGAACTGTTCATCGAAGAATTGACGAGGAGATCGTGGATGATTGCGATGCAGAGCAAGAAGAGGATGCTTCACAAAGAGGATGTGGCTTCCGCCATTTTGGCCACTGATGTTTTCGATTTTCTGATCGGATTGATCTTCAATGAAACCGCCGCCACCGCCTCCGCCGCCGGAAACCTTGCTGAAAGTGAAACTATGTCGATACCTTTCTGA ATGAGGCAAGCGGGAGCATATTCCGGCGTGATGTACTGGAAGACAGGGCCGCACTCACTGCCTTTGGCGAGGATAAAGAAGATCATGAAGAAATCCGGAGAGGAGGTGAAGATGATCTCCGGCGAGGCTCCGATCGTTTTCTCGAAGGCGTGTGAACTGTTCATCGAAGAATTGACGAGGAGATCGTGGATGATTGCGATGCAGAGCAAGAAGAGGATGCTTCACAAAGAGGATGTGGCTTCCGCCATTTTGGCCACTGATGTTTTCGATTTTCTGATCGGATTGATCTTCAATGAAACCGCCGCCACCGCCTCCGCCGCCGGAAACCTTGCTGAAAGTGAAACTATGTCGATACCTTTCTGA MRQAGAYSGVMYWKTGPHSLPLARIKKIMKKSGEEVKMISGEAPIVFSKACELFIEELTRRSWMIAMQSKKRMLHKEDVASAILATDVFDFLIGLIFNETAATASAAGNLAESETMSIPF
BLAST of Lsi07G008950 vs. Swiss-Prot
Match: NFYC4_ARATH (Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.0e-22 Identity = 56/109 (51.38%), Postives = 75/109 (68.81%), Query Frame = 1
BLAST of Lsi07G008950 vs. Swiss-Prot
Match: NFYC1_ARATH (Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.8e-21 Identity = 50/79 (63.29%), Postives = 65/79 (82.28%), Query Frame = 1
BLAST of Lsi07G008950 vs. Swiss-Prot
Match: NFYC3_ARATH (Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.7e-20 Identity = 52/98 (53.06%), Postives = 70/98 (71.43%), Query Frame = 1
BLAST of Lsi07G008950 vs. Swiss-Prot
Match: NFYC9_ARATH (Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.9e-20 Identity = 48/82 (58.54%), Postives = 65/82 (79.27%), Query Frame = 1
BLAST of Lsi07G008950 vs. Swiss-Prot
Match: NFYC2_ARATH (Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2) HSP 1 Score: 99.4 bits (246), Expect = 2.9e-20 Identity = 48/79 (60.76%), Postives = 65/79 (82.28%), Query Frame = 1
BLAST of Lsi07G008950 vs. TrEMBL
Match: A0A0A0KZN6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G049050 PE=4 SV=1) HSP 1 Score: 213.0 bits (541), Expect = 2.0e-52 Identity = 109/118 (92.37%), Postives = 114/118 (96.61%), Query Frame = 1
BLAST of Lsi07G008950 vs. TrEMBL
Match: I1M3F6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_13G284000 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 9.0e-37 Identity = 81/120 (67.50%), Postives = 99/120 (82.50%), Query Frame = 1
BLAST of Lsi07G008950 vs. TrEMBL
Match: A0A0B2RY75_GLYSO (Nuclear transcription factor Y subunit C-1 OS=Glycine soja GN=glysoja_001488 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 9.0e-37 Identity = 81/120 (67.50%), Postives = 99/120 (82.50%), Query Frame = 1
BLAST of Lsi07G008950 vs. TrEMBL
Match: I1LUT9_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_12G217200 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.5e-36 Identity = 81/120 (67.50%), Postives = 98/120 (81.67%), Query Frame = 1
BLAST of Lsi07G008950 vs. TrEMBL
Match: A0A0B2R742_GLYSO (Nuclear transcription factor Y subunit C-4 OS=Glycine soja GN=glysoja_007731 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.5e-36 Identity = 81/120 (67.50%), Postives = 98/120 (81.67%), Query Frame = 1
BLAST of Lsi07G008950 vs. TAIR10
Match: AT5G63470.1 (AT5G63470.1 nuclear factor Y, subunit C4) HSP 1 Score: 105.5 bits (262), Expect = 2.3e-23 Identity = 56/109 (51.38%), Postives = 75/109 (68.81%), Query Frame = 1
BLAST of Lsi07G008950 vs. TAIR10
Match: AT3G48590.1 (AT3G48590.1 nuclear factor Y, subunit C1) HSP 1 Score: 101.7 bits (252), Expect = 3.3e-22 Identity = 50/79 (63.29%), Postives = 65/79 (82.28%), Query Frame = 1
BLAST of Lsi07G008950 vs. TAIR10
Match: AT1G54830.2 (AT1G54830.2 nuclear factor Y, subunit C3) HSP 1 Score: 100.1 bits (248), Expect = 9.6e-22 Identity = 52/98 (53.06%), Postives = 70/98 (71.43%), Query Frame = 1
BLAST of Lsi07G008950 vs. TAIR10
Match: AT1G56170.1 (AT1G56170.1 nuclear factor Y, subunit C2) HSP 1 Score: 99.4 bits (246), Expect = 1.6e-21 Identity = 48/79 (60.76%), Postives = 65/79 (82.28%), Query Frame = 1
BLAST of Lsi07G008950 vs. TAIR10
Match: AT1G08970.4 (AT1G08970.4 nuclear factor Y, subunit C9) HSP 1 Score: 99.4 bits (246), Expect = 1.6e-21 Identity = 48/82 (58.54%), Postives = 65/82 (79.27%), Query Frame = 1
BLAST of Lsi07G008950 vs. NCBI nr
Match: gi|449457660|ref|XP_004146566.1| (PREDICTED: nuclear transcription factor Y subunit C-3-like [Cucumis sativus]) HSP 1 Score: 213.0 bits (541), Expect = 2.9e-52 Identity = 109/118 (92.37%), Postives = 114/118 (96.61%), Query Frame = 1
BLAST of Lsi07G008950 vs. NCBI nr
Match: gi|659102234|ref|XP_008452022.1| (PREDICTED: nuclear transcription factor Y subunit C-1-like [Cucumis melo]) HSP 1 Score: 210.7 bits (535), Expect = 1.4e-51 Identity = 108/118 (91.53%), Postives = 113/118 (95.76%), Query Frame = 1
BLAST of Lsi07G008950 vs. NCBI nr
Match: gi|356546912|ref|XP_003541864.1| (PREDICTED: nuclear transcription factor Y subunit C-1-like [Glycine max]) HSP 1 Score: 161.0 bits (406), Expect = 1.3e-36 Identity = 81/120 (67.50%), Postives = 99/120 (82.50%), Query Frame = 1
BLAST of Lsi07G008950 vs. NCBI nr
Match: gi|356543975|ref|XP_003540433.1| (PREDICTED: nuclear transcription factor Y subunit C-1-like [Glycine max]) HSP 1 Score: 160.2 bits (404), Expect = 2.2e-36 Identity = 81/120 (67.50%), Postives = 98/120 (81.67%), Query Frame = 1
BLAST of Lsi07G008950 vs. NCBI nr
Match: gi|566162320|ref|XP_002304485.2| (hypothetical protein POPTR_0003s12460g [Populus trichocarpa]) HSP 1 Score: 158.3 bits (399), Expect = 8.4e-36 Identity = 78/104 (75.00%), Postives = 90/104 (86.54%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|