Carg22207 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGCAAGCAGGAGCATATTCCGGCGTGACGTACTGGAAAACAGGGCCGCACTCGCTGCCGTTAGCGAGAATCAAGAAGATCATGAAGAAATCCGGCGAGGATGTGAAGATGATCTCCGCCGAGGCGCCGATCGTCTTCTCGAAAGCGTGTGAACTGTTCGTCGAAGAATTGACGAAGAGATCGTGGATGATTGCGATGCAGAGCAAGAAGAGGATGCTTCACAAAGAGGATGTCGCTTCCGCCATTTTGGCTACAGATATTTTCGATTTTCTAATCGGATTGATCTTCCATGAAACCACCACCGCCGCTTCCGCTTCCGCCGCCGCCGAGCTTCCTGAAAGTGAAACTATGTCCATTCCCGTGGAGATGAGCCCGTTCTTGCAGTCCTGA ATGAGGCAAGCAGGAGCATATTCCGGCGTGACGTACTGGAAAACAGGGCCGCACTCGCTGCCGTTAGCGAGAATCAAGAAGATCATGAAGAAATCCGGCGAGGATGTGAAGATGATCTCCGCCGAGGCGCCGATCGTCTTCTCGAAAGCGTGTGAACTGTTCGTCGAAGAATTGACGAAGAGATCGTGGATGATTGCGATGCAGAGCAAGAAGAGGATGCTTCACAAAGAGGATGTCGCTTCCGCCATTTTGGCTACAGATATTTTCGATTTTCTAATCGGATTGATCTTCCATGAAACCACCACCGCCGCTTCCGCTTCCGCCGCCGCCGAGCTTCCTGAAAGTGAAACTATGTCCATTCCCGTGGAGATGAGCCCGTTCTTGCAGTCCTGA ATGAGGCAAGCAGGAGCATATTCCGGCGTGACGTACTGGAAAACAGGGCCGCACTCGCTGCCGTTAGCGAGAATCAAGAAGATCATGAAGAAATCCGGCGAGGATGTGAAGATGATCTCCGCCGAGGCGCCGATCGTCTTCTCGAAAGCGTGTGAACTGTTCGTCGAAGAATTGACGAAGAGATCGTGGATGATTGCGATGCAGAGCAAGAAGAGGATGCTTCACAAAGAGGATGTCGCTTCCGCCATTTTGGCTACAGATATTTTCGATTTTCTAATCGGATTGATCTTCCATGAAACCACCACCGCCGCTTCCGCTTCCGCCGCCGCCGAGCTTCCTGAAAGTGAAACTATGTCCATTCCCGTGGAGATGAGCCCGTTCTTGCAGTCCTGA MRQAGAYSGVTYWKTGPHSLPLARIKKIMKKSGEDVKMISAEAPIVFSKACELFVEELTKRSWMIAMQSKKRMLHKEDVASAILATDIFDFLIGLIFHETTTAASASAAAELPESETMSIPVEMSPFLQS
BLAST of Carg22207 vs. NCBI nr
Match: XP_022931515.1 (nuclear transcription factor Y subunit C-4-like [Cucurbita moschata]) HSP 1 Score: 251.1 bits (640), Expect = 2.0e-63 Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 0
BLAST of Carg22207 vs. NCBI nr
Match: XP_022985461.1 (nuclear transcription factor Y subunit C-4-like [Cucurbita maxima]) HSP 1 Score: 238.4 bits (607), Expect = 1.3e-59 Identity = 124/132 (93.94%), Postives = 128/132 (96.97%), Query Frame = 0
BLAST of Carg22207 vs. NCBI nr
Match: XP_023552994.1 (nuclear transcription factor Y subunit C-4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 235.0 bits (598), Expect = 1.5e-58 Identity = 123/130 (94.62%), Postives = 125/130 (96.15%), Query Frame = 0
BLAST of Carg22207 vs. NCBI nr
Match: XP_004146566.1 (PREDICTED: nuclear transcription factor Y subunit C-3-like [Cucumis sativus] >KGN53346.1 hypothetical protein Csa_4G049050 [Cucumis sativus]) HSP 1 Score: 200.3 bits (508), Expect = 4.1e-48 Identity = 103/120 (85.83%), Postives = 110/120 (91.67%), Query Frame = 0
BLAST of Carg22207 vs. NCBI nr
Match: XP_022136847.1 (nuclear transcription factor Y subunit C-1-like [Momordica charantia]) HSP 1 Score: 199.5 bits (506), Expect = 6.9e-48 Identity = 101/125 (80.80%), Postives = 111/125 (88.80%), Query Frame = 0
BLAST of Carg22207 vs. TAIR10
Match: AT5G63470.1 (nuclear factor Y, subunit C4) HSP 1 Score: 104.8 bits (260), Expect = 4.2e-23 Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Carg22207 vs. TAIR10
Match: AT3G48590.1 (nuclear factor Y, subunit C1) HSP 1 Score: 104.0 bits (258), Expect = 7.2e-23 Identity = 52/79 (65.82%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of Carg22207 vs. TAIR10
Match: AT1G56170.1 (nuclear factor Y, subunit C2) HSP 1 Score: 100.9 bits (250), Expect = 6.1e-22 Identity = 48/79 (60.76%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of Carg22207 vs. TAIR10
Match: AT1G54830.2 (nuclear factor Y, subunit C3) HSP 1 Score: 100.9 bits (250), Expect = 6.1e-22 Identity = 55/103 (53.40%), Postives = 72/103 (69.90%), Query Frame = 0
BLAST of Carg22207 vs. TAIR10
Match: AT1G08970.4 (nuclear factor Y, subunit C9) HSP 1 Score: 99.8 bits (247), Expect = 1.4e-21 Identity = 49/76 (64.47%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of Carg22207 vs. Swiss-Prot
Match: sp|Q9FMV5|NFYC4_ARATH (Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana OX=3702 GN=NFYC4 PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.6e-22 Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Carg22207 vs. Swiss-Prot
Match: sp|Q9SMP0|NFYC1_ARATH (Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana OX=3702 GN=NFYC1 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.3e-21 Identity = 52/79 (65.82%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of Carg22207 vs. Swiss-Prot
Match: sp|A6BLW4|NFYC2_ORYSJ (Nuclear transcription factor Y subunit C-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC2 PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.2e-21 Identity = 53/91 (58.24%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of Carg22207 vs. Swiss-Prot
Match: sp|Q655V5|NFYC4_ORYSJ (Nuclear transcription factor Y subunit C-4 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC4 PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.9e-21 Identity = 49/79 (62.03%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of Carg22207 vs. Swiss-Prot
Match: sp|Q9XE33|NFYC6_ORYSJ (Nuclear transcription factor Y subunit C-6 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC6 PE=1 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 8.4e-21 Identity = 50/92 (54.35%), Postives = 71/92 (77.17%), Query Frame = 0
BLAST of Carg22207 vs. TrEMBL
Match: tr|A0A0A0KZN6|A0A0A0KZN6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G049050 PE=4 SV=1) HSP 1 Score: 200.3 bits (508), Expect = 2.7e-48 Identity = 103/120 (85.83%), Postives = 110/120 (91.67%), Query Frame = 0
BLAST of Carg22207 vs. TrEMBL
Match: tr|A0A1S3BSA0|A0A1S3BSA0_CUCME (nuclear transcription factor Y subunit C-1-like OS=Cucumis melo OX=3656 GN=LOC103493153 PE=4 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 6.6e-47 Identity = 100/120 (83.33%), Postives = 109/120 (90.83%), Query Frame = 0
BLAST of Carg22207 vs. TrEMBL
Match: tr|B9RC88|B9RC88_RICCO (Ccaat-binding transcription factor, putative OS=Ricinus communis OX=3988 GN=RCOM_1686190 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 9.9e-35 Identity = 76/100 (76.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of Carg22207 vs. TrEMBL
Match: tr|B9GWG1|B9GWG1_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_003G124500v3 PE=4 SV=2) HSP 1 Score: 154.1 bits (388), Expect = 2.2e-34 Identity = 77/100 (77.00%), Postives = 86/100 (86.00%), Query Frame = 0
BLAST of Carg22207 vs. TrEMBL
Match: tr|A0A067K0Y6|A0A067K0Y6_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_20620 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.8e-34 Identity = 77/111 (69.37%), Postives = 93/111 (83.78%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|