Lsi03G005930 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.TAAAAAGTCCGCGTTCTTGTTCATTATACGAAGTCTTATAGTTATAGAGTTCTCCTCTCTCTCTGTTTTGCAACAAAGAAATCGAAAGATCAATCCGATCGTTTCAAGAAATCTCAAAGAGAAAAAGAGAGGGAAATATGAGTTACTACGCCCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCACAAGGTAACATCTAAAAACCATTACTCTTTCCTCTCTTACTTCTCCTCCGTTGCACTTTCTTGAAATTCTAAGATCCAGATCGAATGGATCTTACTTTTTCTTTCCGCAAAATTGATCTACTCTTTGTTTTCATCTCGCTTTCGCGCTTTGATTTGTTGAATTTTGACGATTTTAGGTTATCCGCCGGCAGGATATCCTCCGAAGGACGCTTATCCGCCGGCAGGATATCCACCGCAGGGCGGTTATCCACCTGCTGGTTATCCTCCGCAGGGATATCCACCTCCGCCGGCGTATGGTCCGGCGTATGGTCACCCTCCGCCTCAACATCAAAACCAAAAGAAAGAAGTCGGATTCGTCGAAGGCTGGTAA TAAAAAGTCCGCGTTCTTGTTCATTATACGAAGTCTTATAGTTATAGAGTTCTCCTCTCTCTCTGTTTTGCAACAAAGAAATCGAAAGATCAATCCGATCGTTTCAAGAAATCTCAAAGAGAAAAAGAGAGGGAAATATGAGTTACTACGCCCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCACAAGGTTATCCGCCGGCAGGATATCCTCCGAAGGACGCTTATCCGCCGGCAGGATATCCACCGCAGGGCGGTTATCCACCTGCTGGTTATCCTCCGCAGGGATATCCACCTCCGCCGGCGTATGGTCCGGCGTATGGTCACCCTCCGCCTCAACATCAAAACCAAAAGAAAGAAGTCGGATTCGTCGAAGGCTGGTAA ATGAGTTACTACGCCCAGCCACCGCCTCCCGTCGGCGTTCCTCCGCCACAAGGTTATCCGCCGGCAGGATATCCTCCGAAGGACGCTTATCCGCCGGCAGGATATCCACCGCAGGGCGGTTATCCACCTGCTGGTTATCCTCCGCAGGGATATCCACCTCCGCCGGCGTATGGTCCGGCGTATGGTCACCCTCCGCCTCAACATCAAAACCAAAAGAAAGAAGTCGGATTCGTCGAAGGCTGGTAA MSYYAQPPPPVGVPPPQGYPPAGYPPKDAYPPAGYPPQGGYPPAGYPPQGYPPPPAYGPAYGHPPPQHQNQKKEVGFVEGW
BLAST of Lsi03G005930 vs. Swiss-Prot
Match: CYT1A_ARATH (Cysteine-rich and transmembrane domain-containing protein A OS=Arabidopsis thaliana GN=At2g41420 PE=3 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.1e-18 Identity = 59/87 (67.82%), Postives = 61/87 (70.11%), Query Frame = 1
BLAST of Lsi03G005930 vs. Swiss-Prot
Match: CYT1B_ARATH (Cysteine-rich and transmembrane domain-containing protein B OS=Arabidopsis thaliana GN=At3g57160 PE=3 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 4.1e-10 Identity = 47/86 (54.65%), Postives = 50/86 (58.14%), Query Frame = 1
BLAST of Lsi03G005930 vs. Swiss-Prot
Match: OPSD_LOLFO (Rhodopsin OS=Loligo forbesi GN=RHO PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.5e-09 Identity = 39/53 (73.58%), Postives = 39/53 (73.58%), Query Frame = 1
BLAST of Lsi03G005930 vs. Swiss-Prot
Match: OPSD_ALLSU (Rhodopsin (Fragment) OS=Alloteuthis subulata GN=RHO PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.5e-09 Identity = 39/53 (73.58%), Postives = 39/53 (73.58%), Query Frame = 1
BLAST of Lsi03G005930 vs. Swiss-Prot
Match: OPSD_ENTDO (Rhodopsin OS=Enteroctopus dofleini GN=RHO PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.7e-09 Identity = 44/70 (62.86%), Postives = 45/70 (64.29%), Query Frame = 1
BLAST of Lsi03G005930 vs. TrEMBL
Match: A0A0A0K2W8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070830 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.7e-34 Identity = 76/80 (95.00%), Postives = 76/80 (95.00%), Query Frame = 1
BLAST of Lsi03G005930 vs. TrEMBL
Match: A0A0D2ST80_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G020000 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.4e-19 Identity = 59/84 (70.24%), Postives = 60/84 (71.43%), Query Frame = 1
BLAST of Lsi03G005930 vs. TrEMBL
Match: A0A067LB92_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_16346 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.7e-19 Identity = 58/74 (78.38%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of Lsi03G005930 vs. TrEMBL
Match: U5G3V1_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0009s09010g PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.5e-19 Identity = 59/83 (71.08%), Postives = 60/83 (72.29%), Query Frame = 1
BLAST of Lsi03G005930 vs. TrEMBL
Match: A0A022RH20_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a021603mg PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.3e-18 Identity = 59/81 (72.84%), Postives = 60/81 (74.07%), Query Frame = 1
BLAST of Lsi03G005930 vs. TAIR10
Match: AT2G41420.1 (AT2G41420.1 proline-rich family protein) HSP 1 Score: 93.6 bits (231), Expect = 6.0e-20 Identity = 59/87 (67.82%), Postives = 61/87 (70.11%), Query Frame = 1
BLAST of Lsi03G005930 vs. TAIR10
Match: AT3G49845.1 (AT3G49845.1 unknown protein) HSP 1 Score: 66.2 bits (160), Expect = 1.0e-11 Identity = 49/98 (50.00%), Postives = 55/98 (56.12%), Query Frame = 1
BLAST of Lsi03G005930 vs. TAIR10
Match: AT5G67600.1 (AT5G67600.1 unknown protein) HSP 1 Score: 60.5 bits (145), Expect = 5.7e-10 Identity = 44/80 (55.00%), Postives = 48/80 (60.00%), Query Frame = 1
BLAST of Lsi03G005930 vs. TAIR10
Match: AT5G17650.1 (AT5G17650.1 glycine/proline-rich protein) HSP 1 Score: 59.3 bits (142), Expect = 1.3e-09 Identity = 38/67 (56.72%), Postives = 41/67 (61.19%), Query Frame = 1
BLAST of Lsi03G005930 vs. TAIR10
Match: AT5G45350.1 (AT5G45350.1 proline-rich family protein) HSP 1 Score: 57.0 bits (136), Expect = 6.3e-09 Identity = 39/67 (58.21%), Postives = 39/67 (58.21%), Query Frame = 1
BLAST of Lsi03G005930 vs. NCBI nr
Match: gi|778724815|ref|XP_011658867.1| (PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 5.3e-34 Identity = 76/80 (95.00%), Postives = 76/80 (95.00%), Query Frame = 1
BLAST of Lsi03G005930 vs. NCBI nr
Match: gi|659110097|ref|XP_008455047.1| (PREDICTED: CYSTM1 family protein A-like [Cucumis melo]) HSP 1 Score: 141.7 bits (356), Expect = 5.5e-31 Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 1
BLAST of Lsi03G005930 vs. NCBI nr
Match: gi|763780233|gb|KJB47304.1| (hypothetical protein B456_008G020000 [Gossypium raimondii]) HSP 1 Score: 102.1 bits (253), Expect = 4.8e-19 Identity = 59/84 (70.24%), Postives = 60/84 (71.43%), Query Frame = 1
BLAST of Lsi03G005930 vs. NCBI nr
Match: gi|643738592|gb|KDP44513.1| (hypothetical protein JCGZ_16346 [Jatropha curcas]) HSP 1 Score: 101.3 bits (251), Expect = 8.2e-19 Identity = 58/74 (78.38%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of Lsi03G005930 vs. NCBI nr
Match: gi|802550735|ref|XP_012093141.1| (PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Jatropha curcas]) HSP 1 Score: 101.3 bits (251), Expect = 8.2e-19 Identity = 58/74 (78.38%), Postives = 59/74 (79.73%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |