Lsi02G002080 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGCATCACAGATTGCACTAAGTATCTTAATGATGTTTATCATGGTGGAGATTTCAATGGCAGTGACATGCAGTCCAGTGCAACTGAGTTCCTGTGTTAGTGCAATCACATCTTCAGTTCCACCTTCTAAGCTCTGCTGTTCTAAGATTAAGGAACAGAAACCCTGCCTCTGCAAGTACATGCAGAACCCCACTCTAAAGAAGTTTGTGGCCTCTCCCAATGCCAGGAAAGTTGCTAACACTTGTGGAACTCCATTTCCCAAGTGCTAG ATGAAGGCATCACAGATTGCACTAAGTATCTTAATGATGTTTATCATGGTGGAGATTTCAATGGCAGTGACATGCAGTCCAGTGCAACTGAGTTCCTGTGTTAGTGCAATCACATCTTCAGTTCCACCTTCTAAGCTCTGCTGTTCTAAGATTAAGGAACAGAAACCCTGCCTCTGCAAGTACATGCAGAACCCCACTCTAAAGAAGTTTGTGGCCTCTCCCAATGCCAGGAAAGTTGCTAACACTTGTGGAACTCCATTTCCCAAGTGCTAG ATGAAGGCATCACAGATTGCACTAAGTATCTTAATGATGTTTATCATGGTGGAGATTTCAATGGCAGTGACATGCAGTCCAGTGCAACTGAGTTCCTGTGTTAGTGCAATCACATCTTCAGTTCCACCTTCTAAGCTCTGCTGTTCTAAGATTAAGGAACAGAAACCCTGCCTCTGCAAGTACATGCAGAACCCCACTCTAAAGAAGTTTGTGGCCTCTCCCAATGCCAGGAAAGTTGCTAACACTTGTGGAACTCCATTTCCCAAGTGCTAG MKASQIALSILMMFIMVEISMAVTCSPVQLSSCVSAITSSVPPSKLCCSKIKEQKPCLCKYMQNPTLKKFVASPNARKVANTCGTPFPKC
BLAST of Lsi02G002080 vs. Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.0e-18 Identity = 39/68 (57.35%), Postives = 52/68 (76.47%), Query Frame = 1
BLAST of Lsi02G002080 vs. Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.0e-17 Identity = 43/93 (46.24%), Postives = 64/93 (68.82%), Query Frame = 1
BLAST of Lsi02G002080 vs. Swiss-Prot
Match: NLTP2_APIGA (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum PE=1 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.1e-16 Identity = 40/67 (59.70%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Lsi02G002080 vs. Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.5e-10 Identity = 31/91 (34.07%), Postives = 51/91 (56.04%), Query Frame = 1
BLAST of Lsi02G002080 vs. Swiss-Prot
Match: NLT2P_WHEAT (Non-specific lipid-transfer protein 2P OS=Triticum aestivum PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.0e-09 Identity = 27/66 (40.91%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of Lsi02G002080 vs. TrEMBL
Match: A0A0A0LVT5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G042560 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 5.5e-39 Identity = 85/90 (94.44%), Postives = 89/90 (98.89%), Query Frame = 1
BLAST of Lsi02G002080 vs. TrEMBL
Match: B7FM99_MEDTR (Chitinase / Hevein / PR-4 / Wheatwin2 OS=Medicago truncatula GN=MTR_6g082480 PE=2 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 7.2e-31 Identity = 70/92 (76.09%), Postives = 83/92 (90.22%), Query Frame = 1
BLAST of Lsi02G002080 vs. TrEMBL
Match: V7C3M6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_004G154200g PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.2e-30 Identity = 71/92 (77.17%), Postives = 82/92 (89.13%), Query Frame = 1
BLAST of Lsi02G002080 vs. TrEMBL
Match: I3S1H2_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.6e-30 Identity = 70/92 (76.09%), Postives = 82/92 (89.13%), Query Frame = 1
BLAST of Lsi02G002080 vs. TrEMBL
Match: A0A151R929_CAJCA (Putative non-specific lipid-transfer protein AKCS9 (Fragment) OS=Cajanus cajan GN=KK1_039546 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 4.7e-30 Identity = 70/92 (76.09%), Postives = 81/92 (88.04%), Query Frame = 1
BLAST of Lsi02G002080 vs. TAIR10
Match: AT3G18280.1 (AT3G18280.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 108.2 bits (269), Expect = 2.6e-24 Identity = 50/87 (57.47%), Postives = 70/87 (80.46%), Query Frame = 1
BLAST of Lsi02G002080 vs. TAIR10
Match: AT1G48750.1 (AT1G48750.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 106.7 bits (265), Expect = 7.7e-24 Identity = 49/90 (54.44%), Postives = 72/90 (80.00%), Query Frame = 1
BLAST of Lsi02G002080 vs. TAIR10
Match: AT5G38170.1 (AT5G38170.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 82.8 bits (203), Expect = 1.2e-16 Identity = 35/68 (51.47%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Lsi02G002080 vs. TAIR10
Match: AT5G38160.1 (AT5G38160.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 80.5 bits (197), Expect = 5.9e-16 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of Lsi02G002080 vs. TAIR10
Match: AT1G73780.1 (AT1G73780.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 79.3 bits (194), Expect = 1.3e-15 Identity = 37/85 (43.53%), Postives = 56/85 (65.88%), Query Frame = 1
BLAST of Lsi02G002080 vs. NCBI nr
Match: gi|449439421|ref|XP_004137484.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 7.9e-39 Identity = 85/90 (94.44%), Postives = 89/90 (98.89%), Query Frame = 1
BLAST of Lsi02G002080 vs. NCBI nr
Match: gi|659066780|ref|XP_008460998.1| (PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]) HSP 1 Score: 165.2 bits (417), Expect = 5.1e-38 Identity = 83/90 (92.22%), Postives = 89/90 (98.89%), Query Frame = 1
BLAST of Lsi02G002080 vs. NCBI nr
Match: gi|357500235|ref|XP_003620406.1| (Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]) HSP 1 Score: 141.0 bits (354), Expect = 1.0e-30 Identity = 70/92 (76.09%), Postives = 83/92 (90.22%), Query Frame = 1
BLAST of Lsi02G002080 vs. NCBI nr
Match: gi|593704703|ref|XP_007152725.1| (hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]) HSP 1 Score: 140.2 bits (352), Expect = 1.8e-30 Identity = 71/92 (77.17%), Postives = 82/92 (89.13%), Query Frame = 1
BLAST of Lsi02G002080 vs. NCBI nr
Match: gi|388492096|gb|AFK34114.1| (unknown [Medicago truncatula]) HSP 1 Score: 139.8 bits (351), Expect = 2.3e-30 Identity = 70/92 (76.09%), Postives = 82/92 (89.13%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|