Cucsa.169390 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TTGGGTGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACGATCTGTCGTTCCAGCAACTGCTCAGCTACGCAGAGGAAGAGTTTGGATTCCATCATCCTCAAGGGGGCCTAACAATCCCTTGCAAAGAAGATGCCTTCGTTGATCTCACTTCTAAATTGCAAGTATCTTGA TTGGGTGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACGATCTGTCGTTCCAGCAACTGCTCAGCTACGCAGAGGAAGAGTTTGGATTCCATCATCCTCAAGGGGGCCTAACAATCCCTTGCAAAGAAGATGCCTTCGTTGATCTCACTTCTAAATTGCAAGTATCTTGA TTGGGTGTTCCAAAAGGCCATGTTGCCGTTTATGTGGGAGAGATTCAAATGAAGCGGTTCGTGGTTCCAATATCTTACCTAAACGATCTGTCGTTCCAGCAACTGCTCAGCTACGCAGAGGAAGAGTTTGGATTCCATCATCCTCAAGGGGGCCTAACAATCCCTTGCAAAGAAGATGCCTTCGTTGATCTCACTTCTAAATTGCAAGTATCTTGA LGVPKGHVAVYVGEIQMKRFVVPISYLNDLSFQQLLSYAEEEFGFHHPQGGLTIPCKEDAFVDLTSKLQVS*
BLAST of Cucsa.169390 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 6.0e-21 Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.169390 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-20 Identity = 46/66 (69.70%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Cucsa.169390 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 1.7e-20 Identity = 45/66 (68.18%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.169390 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.0e-20 Identity = 45/65 (69.23%), Postives = 54/65 (83.08%), Query Frame = 1
BLAST of Cucsa.169390 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.0e-20 Identity = 45/66 (68.18%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.169390 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 8.1e-33 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Cucsa.169390 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 9.2e-29 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of Cucsa.169390 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.3e-27 Identity = 62/71 (87.32%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of Cucsa.169390 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 5.1e-27 Identity = 59/71 (83.10%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of Cucsa.169390 vs. TrEMBL
Match: A0A0A0LPI5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258770 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.1e-26 Identity = 60/71 (84.51%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of Cucsa.169390 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 3.4e-22 Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.169390 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 3.4e-22 Identity = 47/67 (70.15%), Postives = 54/67 (80.60%), Query Frame = 1
BLAST of Cucsa.169390 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.8 bits (247), Expect = 7.5e-22 Identity = 46/66 (69.70%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Cucsa.169390 vs. TAIR10
Match: AT5G18050.1 (AT5G18050.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.4 bits (246), Expect = 9.8e-22 Identity = 45/66 (68.18%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.169390 vs. TAIR10
Match: AT5G18030.1 (AT5G18030.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 98.6 bits (244), Expect = 1.7e-21 Identity = 45/66 (68.18%), Postives = 55/66 (83.33%), Query Frame = 1
BLAST of Cucsa.169390 vs. NCBI nr
Match: gi|700206764|gb|KGN61883.1| (hypothetical protein Csa_2G258790 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 1.2e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Cucsa.169390 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 1.3e-28 Identity = 64/71 (90.14%), Postives = 67/71 (94.37%), Query Frame = 1
BLAST of Cucsa.169390 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 132.9 bits (333), Expect = 2.3e-28 Identity = 64/71 (90.14%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of Cucsa.169390 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 131.0 bits (328), Expect = 8.6e-28 Identity = 63/71 (88.73%), Postives = 66/71 (92.96%), Query Frame = 1
BLAST of Cucsa.169390 vs. NCBI nr
Match: gi|778669593|ref|XP_011649273.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 1.9e-27 Identity = 62/71 (87.32%), Postives = 66/71 (92.96%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|