Cucsa.059610 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTCCCAAGAACCAAATCCCCCAATCGGAATCTGGGTTCCAAGATTGGCTGCCCGTCATGGCTGGAAACCTCGGCGGCGAGGGGCTGATCGGAGAGCTCTGTAATGGGTTCAATCTGCTGATGGATAGAGAGAAGGGAGTGATCAATTTCGAGAGCTTGAAGAGGAATGCGGCGGCTTTAGGGCTCGGGGATTTGAGTGATGATGAACTCCGAGGAATGTTGCGGGAAGGGGATTTTGATGGCGATGGCGCTCTTAATCAGATGGAATTTTGTGTTCTTATGTTTAGATTAAGTCCTGAATTGATGGAAGCTTCTC ATGACTCCCAAGAACCAAATCCCCCAATCGGAATCTGGGTTCCAAGATTGGCTGCCCGTCATGGCTGGAAACCTCGGCGGCGAGGGGCTGATCGGAGAGCTCTGTAATGGGTTCAATCTGCTGATGGATAGAGAGAAGGGAGTGATCAATTTCGAGAGCTTGAAGAGGAATGCGGCGGCTTTAGGGCTCGGGGATTTGAGTGATGATGAACTCCGAGGAATGTTGCGGGAAGGGGATTTTGATGGCGATGGCGCTCTTAATCAGATGGAATTTTGTGTTCTTATGTTTAGATTAAGTCCTGAATTGATGGAAGCTTCTC ATGACTCCCAAGAACCAAATCCCCCAATCGGAATCTGGGTTCCAAGATTGGCTGCCCGTCATGGCTGGAAACCTCGGCGGCGAGGGGCTGATCGGAGAGCTCTGTAATGGGTTCAATCTGCTGATGGATAGAGAGAAGGGAGTGATCAATTTCGAGAGCTTGAAGAGGAATGCGGCGGCTTTAGGGCTCGGGGATTTGAGTGATGATGAACTCCGAGGAATGTTGCGGGAAGGGGATTTTGATGGCGATGGCGCTCTTAATCAGATGGAATTTTGTGTTCTTATGTTTAGATTAAGTCCTGAATTGATGGAAGCTTCTC MTPKNQIPQSESGFQDWLPVMAGNLGGEGLIGELCNGFNLLMDREKGVINFESLKRNAAALGLGDLSDDELRGMLREGDFDGDGALNQMEFCVLMFRLSPELMEASX
BLAST of Cucsa.059610 vs. Swiss-Prot
Match: PBP1_ARATH (Calcium-binding protein PBP1 OS=Arabidopsis thaliana GN=PBP1 PE=1 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.3e-35 Identity = 76/104 (73.08%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.059610 vs. Swiss-Prot
Match: KIC_ARATH (Calcium-binding protein KIC OS=Arabidopsis thaliana GN=KIC PE=1 SV=2) HSP 1 Score: 112.1 bits (279), Expect = 3.8e-24 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 1
BLAST of Cucsa.059610 vs. Swiss-Prot
Match: CETN2_BOVIN (Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.5e-09 Identity = 36/86 (41.86%), Postives = 51/86 (59.30%), Query Frame = 1
BLAST of Cucsa.059610 vs. Swiss-Prot
Match: CETN2_MOUSE (Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 7.8e-09 Identity = 35/86 (40.70%), Postives = 51/86 (59.30%), Query Frame = 1
BLAST of Cucsa.059610 vs. Swiss-Prot
Match: CETN1_HUMAN (Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.7e-08 Identity = 35/86 (40.70%), Postives = 51/86 (59.30%), Query Frame = 1
BLAST of Cucsa.059610 vs. TrEMBL
Match: A0A0A0L2H0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G081900 PE=4 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 7.2e-54 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Cucsa.059610 vs. TrEMBL
Match: A0A0A0L347_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G099590 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.4e-41 Identity = 85/96 (88.54%), Postives = 91/96 (94.79%), Query Frame = 1
BLAST of Cucsa.059610 vs. TrEMBL
Match: A0A0D2NJQ7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G078700 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.9e-38 Identity = 80/97 (82.47%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Cucsa.059610 vs. TrEMBL
Match: A0A0D2VEP2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G165400 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 9.5e-38 Identity = 78/95 (82.11%), Postives = 88/95 (92.63%), Query Frame = 1
BLAST of Cucsa.059610 vs. TrEMBL
Match: A0A061F769_THECC (Calcium-binding EF-hand family protein OS=Theobroma cacao GN=TCM_031234 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 3.6e-37 Identity = 77/97 (79.38%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Cucsa.059610 vs. TAIR10
Match: AT4G27280.1 (AT4G27280.1 Calcium-binding EF-hand family protein) HSP 1 Score: 161.0 bits (406), Expect = 4.1e-40 Identity = 82/105 (78.10%), Postives = 91/105 (86.67%), Query Frame = 1
BLAST of Cucsa.059610 vs. TAIR10
Match: AT5G54490.1 (AT5G54490.1 pinoid-binding protein 1) HSP 1 Score: 150.2 bits (378), Expect = 7.2e-37 Identity = 76/104 (73.08%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.059610 vs. TAIR10
Match: AT2G46600.1 (AT2G46600.1 Calcium-binding EF-hand family protein) HSP 1 Score: 112.1 bits (279), Expect = 2.2e-25 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 1
BLAST of Cucsa.059610 vs. NCBI nr
Match: gi|449470409|ref|XP_004152909.1| (PREDICTED: calcium-binding protein PBP1 [Cucumis sativus]) HSP 1 Score: 217.6 bits (553), Expect = 1.0e-53 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Cucsa.059610 vs. NCBI nr
Match: gi|659126968|ref|XP_008463452.1| (PREDICTED: calcium-binding protein PBP1-like [Cucumis melo]) HSP 1 Score: 204.1 bits (518), Expect = 1.2e-49 Identity = 100/106 (94.34%), Postives = 101/106 (95.28%), Query Frame = 1
BLAST of Cucsa.059610 vs. NCBI nr
Match: gi|449463164|ref|XP_004149304.1| (PREDICTED: calcium-binding protein PBP1 [Cucumis sativus]) HSP 1 Score: 176.8 bits (447), Expect = 2.0e-41 Identity = 85/96 (88.54%), Postives = 91/96 (94.79%), Query Frame = 1
BLAST of Cucsa.059610 vs. NCBI nr
Match: gi|659102784|ref|XP_008452312.1| (PREDICTED: calcium-binding protein PBP1 [Cucumis melo]) HSP 1 Score: 175.3 bits (443), Expect = 5.9e-41 Identity = 84/96 (87.50%), Postives = 90/96 (93.75%), Query Frame = 1
BLAST of Cucsa.059610 vs. NCBI nr
Match: gi|823131730|ref|XP_012459273.1| (PREDICTED: calcium-binding protein PBP1 [Gossypium raimondii]) HSP 1 Score: 166.4 bits (420), Expect = 2.7e-38 Identity = 80/97 (82.47%), Postives = 89/97 (91.75%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|