Csa7G432210 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGAACAAAACCGCTTCCTCTTCCCGCCTCTGCCTCTGTGCTCCCACCACCCATCCCGGCTCTTTCCGCTGCAGCCTCCACCGTCGTCTTTCGAATTCCTCCCACAAAACCCCGCCGCTGCCGCCTCCTTCTCCGCGTGGAAGCCAGTCGAAGGCGGCAGCGACGACGACGGATCATCATTTGCTTAAGGCGTTTCTGATGCAGATCGTAAAGCCGTCGAGTCATGATCTTCAAAGACGGGGAAGTTTCGAGCCTAAACCTTCTCGATTCTGCAGTGTCGTCTCTGCTTCGGATCCTCGTTTGGCTGTTTCTTGA ATGCCGAACAAAACCGCTTCCTCTTCCCGCCTCTGCCTCTGTGCTCCCACCACCCATCCCGGCTCTTTCCGCTGCAGCCTCCACCGTCGTCTTTCGAATTCCTCCCACAAAACCCCGCCGCTGCCGCCTCCTTCTCCGCGTGGAAGCCAGTCGAAGGCGGCAGCGACGACGACGGATCATCATTTGCTTAAGGCGTTTCTGATGCAGATCGTAAAGCCGTCGAGTCATGATCTTCAAAGACGGGGAAGTTTCGAGCCTAAACCTTCTCGATTCTGCAGTGTCGTCTCTGCTTCGGATCCTCGTTTGGCTGTTTCTTGA ATGCCGAACAAAACCGCTTCCTCTTCCCGCCTCTGCCTCTGTGCTCCCACCACCCATCCCGGCTCTTTCCGCTGCAGCCTCCACCGTCGTCTTTCGAATTCCTCCCACAAAACCCCGCCGCTGCCGCCTCCTTCTCCGCGTGGAAGCCAGTCGAAGGCGGCAGCGACGACGACGGATCATCATTTGCTTAAGGCGTTTCTGATGCAGATCGTAAAGCCGTCGAGTCATGATCTTCAAAGACGGGGAAGTTTCGAGCCTAAACCTTCTCGATTCTGCAGTGTCGTCTCTGCTTCGGATCCTCGTTTGGCTGTTTCTTGA MPNKTASSSRLCLCAPTTHPGSFRCSLHRRLSNSSHKTPPLPPPSPRGSQSKAAATTTDHHLLKAFLMQIVKPSSHDLQRRGSFEPKPSRFCSVVSASDPRLAVS*
BLAST of Csa7G432210 vs. TrEMBL
Match: A0A0A0K698_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G432210 PE=4 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 4.2e-54 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
BLAST of Csa7G432210 vs. TrEMBL
Match: A0A061G8R4_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_027325 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.7e-18 Identity = 52/98 (53.06%), Postives = 68/98 (69.39%), Query Frame = 1
BLAST of Csa7G432210 vs. TrEMBL
Match: B9SZN1_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1372180 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.4e-17 Identity = 51/101 (50.50%), Postives = 69/101 (68.32%), Query Frame = 1
BLAST of Csa7G432210 vs. TrEMBL
Match: A0A151SWE2_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_014536 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.4e-17 Identity = 48/105 (45.71%), Postives = 69/105 (65.71%), Query Frame = 1
BLAST of Csa7G432210 vs. TrEMBL
Match: A0A164U5H0_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_025532 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 5.4e-17 Identity = 53/118 (44.92%), Postives = 76/118 (64.41%), Query Frame = 1
BLAST of Csa7G432210 vs. TAIR10
Match: AT5G25280.1 (AT5G25280.1 serine-rich protein-related) HSP 1 Score: 74.3 bits (181), Expect = 5.0e-14 Identity = 38/103 (36.89%), Postives = 56/103 (54.37%), Query Frame = 1
BLAST of Csa7G432210 vs. TAIR10
Match: AT5G11090.1 (AT5G11090.1 serine-rich protein-related) HSP 1 Score: 72.8 bits (177), Expect = 1.4e-13 Identity = 36/104 (34.62%), Postives = 56/104 (53.85%), Query Frame = 1
BLAST of Csa7G432210 vs. TAIR10
Match: AT5G20370.1 (AT5G20370.1 serine-rich protein-related) HSP 1 Score: 57.8 bits (138), Expect = 4.8e-09 Identity = 36/104 (34.62%), Postives = 40/104 (38.46%), Query Frame = 1
BLAST of Csa7G432210 vs. TAIR10
Match: AT1G67910.1 (AT1G67910.1 unknown protein) HSP 1 Score: 50.1 bits (118), Expect = 1.0e-06 Identity = 24/55 (43.64%), Postives = 29/55 (52.73%), Query Frame = 1
BLAST of Csa7G432210 vs. TAIR10
Match: AT3G13227.1 (AT3G13227.1 serine-rich protein-related) HSP 1 Score: 47.4 bits (111), Expect = 6.5e-06 Identity = 19/28 (67.86%), Postives = 21/28 (75.00%), Query Frame = 1
BLAST of Csa7G432210 vs. NCBI nr
Match: gi|700190007|gb|KGN45240.1| (hypothetical protein Csa_7G432210 [Cucumis sativus]) HSP 1 Score: 218.4 bits (555), Expect = 6.0e-54 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
BLAST of Csa7G432210 vs. NCBI nr
Match: gi|659122451|ref|XP_008461151.1| (PREDICTED: uncharacterized protein LOC103499822 [Cucumis melo]) HSP 1 Score: 186.0 bits (471), Expect = 3.3e-44 Identity = 92/106 (86.79%), Postives = 97/106 (91.51%), Query Frame = 1
BLAST of Csa7G432210 vs. NCBI nr
Match: gi|1009182309|ref|XP_015872641.1| (PREDICTED: uncharacterized protein LOC107409728 [Ziziphus jujuba]) HSP 1 Score: 102.4 bits (254), Expect = 4.8e-19 Identity = 50/89 (56.18%), Postives = 63/89 (70.79%), Query Frame = 1
BLAST of Csa7G432210 vs. NCBI nr
Match: gi|590615847|ref|XP_007023339.1| (Uncharacterized protein TCM_027325 [Theobroma cacao]) HSP 1 Score: 100.1 bits (248), Expect = 2.4e-18 Identity = 52/98 (53.06%), Postives = 68/98 (69.39%), Query Frame = 1
BLAST of Csa7G432210 vs. NCBI nr
Match: gi|1000942539|ref|XP_015582253.1| (PREDICTED: uncharacterized protein LOC8286598 [Ricinus communis]) HSP 1 Score: 96.3 bits (238), Expect = 3.5e-17 Identity = 51/101 (50.50%), Postives = 69/101 (68.32%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|