Csa7G009050 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAATTCTTCAGCTTCTCCGACGAGCTTCCACCTCAACAAAGGAAGGGGTGGCAGTAGTTCCAAAGGGCTACTGTGCAGTCTATGTTGGAGAGATTCAAAAGAAGCGTTTTGTCATCCCCATAACTTACTTGAACCAACCATGTTTTCAGATCTTGCTTAGTCAAGCTGAAGAGGAATTTGGTTATTATCATCCTATGGGTGGTCTTACCATTCAGTGCAGAGAAGATATCTTCACCAATCTCATTTCTCAGTTAAATAGGCCGTGA ATGAGAATTCTTCAGCTTCTCCGACGAGCTTCCACCTCAACAAAGGAAGGGGTGGCAGTAGTTCCAAAGGGCTACTGTGCAGTCTATGTTGGAGAGATTCAAAAGAAGCGTTTTGTCATCCCCATAACTTACTTGAACCAACCATGTTTTCAGATCTTGCTTAGTCAAGCTGAAGAGGAATTTGGTTATTATCATCCTATGGGTGGTCTTACCATTCAGTGCAGAGAAGATATCTTCACCAATCTCATTTCTCAGTTAAATAGGCCGTGA ATGAGAATTCTTCAGCTTCTCCGACGAGCTTCCACCTCAACAAAGGAAGGGGTGGCAGTAGTTCCAAAGGGCTACTGTGCAGTCTATGTTGGAGAGATTCAAAAGAAGCGTTTTGTCATCCCCATAACTTACTTGAACCAACCATGTTTTCAGATCTTGCTTAGTCAAGCTGAAGAGGAATTTGGTTATTATCATCCTATGGGTGGTCTTACCATTCAGTGCAGAGAAGATATCTTCACCAATCTCATTTCTCAGTTAAATAGGCCGTGA MRILQLLRRASTSTKEGVAVVPKGYCAVYVGEIQKKRFVIPITYLNQPCFQILLSQAEEEFGYYHPMGGLTIQCREDIFTNLISQLNRP*
BLAST of Csa7G009050 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.0e-21 Identity = 47/87 (54.02%), Postives = 64/87 (73.56%), Query Frame = 1
BLAST of Csa7G009050 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.3e-21 Identity = 48/84 (57.14%), Postives = 62/84 (73.81%), Query Frame = 1
BLAST of Csa7G009050 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.7e-21 Identity = 49/76 (64.47%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of Csa7G009050 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.5e-21 Identity = 46/86 (53.49%), Postives = 62/86 (72.09%), Query Frame = 1
BLAST of Csa7G009050 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.3e-20 Identity = 51/89 (57.30%), Postives = 63/89 (70.79%), Query Frame = 1
BLAST of Csa7G009050 vs. TrEMBL
Match: A0A0A0K2F9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009050 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 1.7e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Csa7G009050 vs. TrEMBL
Match: A0A0A0K4K1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009080 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 8.8e-29 Identity = 64/87 (73.56%), Postives = 72/87 (82.76%), Query Frame = 1
BLAST of Csa7G009050 vs. TrEMBL
Match: A0A0A0K5U4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009070 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.5e-28 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Csa7G009050 vs. TrEMBL
Match: A0A0A0K5V1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009120 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.8e-27 Identity = 61/87 (70.11%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Csa7G009050 vs. TrEMBL
Match: B9HRD0_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0009s12990g PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.3e-24 Identity = 58/88 (65.91%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Csa7G009050 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.8 bits (255), Expect = 1.1e-22 Identity = 47/87 (54.02%), Postives = 64/87 (73.56%), Query Frame = 1
BLAST of Csa7G009050 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.1 bits (253), Expect = 1.9e-22 Identity = 48/84 (57.14%), Postives = 62/84 (73.81%), Query Frame = 1
BLAST of Csa7G009050 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.7 bits (252), Expect = 2.5e-22 Identity = 51/86 (59.30%), Postives = 62/86 (72.09%), Query Frame = 1
BLAST of Csa7G009050 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 3.2e-22 Identity = 49/76 (64.47%), Postives = 58/76 (76.32%), Query Frame = 1
BLAST of Csa7G009050 vs. TAIR10
Match: AT5G18050.1 (AT5G18050.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 4.2e-22 Identity = 46/86 (53.49%), Postives = 62/86 (72.09%), Query Frame = 1
BLAST of Csa7G009050 vs. NCBI nr
Match: gi|700187976|gb|KGN43209.1| (hypothetical protein Csa_7G009050 [Cucumis sativus]) HSP 1 Score: 183.0 bits (463), Expect = 2.4e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Csa7G009050 vs. NCBI nr
Match: gi|700187979|gb|KGN43212.1| (hypothetical protein Csa_7G009080 [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 1.3e-28 Identity = 64/87 (73.56%), Postives = 72/87 (82.76%), Query Frame = 1
BLAST of Csa7G009050 vs. NCBI nr
Match: gi|778722852|ref|XP_011658582.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 133.3 bits (334), Expect = 2.2e-28 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Csa7G009050 vs. NCBI nr
Match: gi|700187983|gb|KGN43216.1| (hypothetical protein Csa_7G009120 [Cucumis sativus]) HSP 1 Score: 129.0 bits (323), Expect = 4.1e-27 Identity = 61/87 (70.11%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Csa7G009050 vs. NCBI nr
Match: gi|224103275|ref|XP_002312992.1| (hypothetical protein POPTR_0009s12990g [Populus trichocarpa]) HSP 1 Score: 119.4 bits (298), Expect = 3.2e-24 Identity = 58/88 (65.91%), Postives = 71/88 (80.68%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |