Csa6G445100 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.TTCCCATATATAGTTAGCAATGTCTAAGGATCTTGACCCTGCTTTTCCCACCGGCGACTACTTCGATCATCCCCCCGCTCCCTTCTTCGACCCTGAAGAGCTCTTGCGGTGGTCCTTTTACAGAGCTGTTATTGCCGAGTTCATTGCTACTCTTTTGTTTTTGTATGTTGGAGTTCTCACTGTGATTGGAAGTCAGAGTCAGGATTCTGCCGCTGTATGCGGCGGCGTTGGTGTTCAGGGCATTGCTTGGGCGTTCGGCGGCACCATCTTTGTTCTCGTTTACTGCACCGCCGGCATTTCTGGCAAGCTCTTCTACTCTTTCTTTCTCCCTCGTGTATGA ATGTCTAAGGATCTTGACCCTGCTTTTCCCACCGGCGACTACTTCGATCATCCCCCCGCTCCCTTCTTCGACCCTGAAGAGCTCTTGCGGTGGTCCTTTTACAGAGCTGTTATTGCCGAGTTCATTGCTACTCTTTTGTTTTTGTATGTTGGAGTTCTCACTGTGATTGGAAGTCAGAGTCAGGATTCTGCCGCTGTATGCGGCGGCGTTGGTGTTCAGGGCATTGCTTGGGCGTTCGGCGGCACCATCTTTGTTCTCGTTTACTGCACCGCCGGCATTTCTGGCAAGCTCTTCTACTCTTTCTTTCTCCCTCGTGTATGA ATGTCTAAGGATCTTGACCCTGCTTTTCCCACCGGCGACTACTTCGATCATCCCCCCGCTCCCTTCTTCGACCCTGAAGAGCTCTTGCGGTGGTCCTTTTACAGAGCTGTTATTGCCGAGTTCATTGCTACTCTTTTGTTTTTGTATGTTGGAGTTCTCACTGTGATTGGAAGTCAGAGTCAGGATTCTGCCGCTGTATGCGGCGGCGTTGGTGTTCAGGGCATTGCTTGGGCGTTCGGCGGCACCATCTTTGTTCTCGTTTACTGCACCGCCGGCATTTCTGGCAAGCTCTTCTACTCTTTCTTTCTCCCTCGTGTATGA MSKDLDPAFPTGDYFDHPPAPFFDPEELLRWSFYRAVIAEFIATLLFLYVGVLTVIGSQSQDSAAVCGGVGVQGIAWAFGGTIFVLVYCTAGISGKLFYSFFLPRV*
BLAST of Csa6G445100 vs. Swiss-Prot
Match: PIP23_ARATH (Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.6e-30 Identity = 67/101 (66.34%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Csa6G445100 vs. Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 6.1e-30 Identity = 70/105 (66.67%), Postives = 75/105 (71.43%), Query Frame = 1
BLAST of Csa6G445100 vs. Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2) HSP 1 Score: 130.6 bits (327), Expect = 1.0e-29 Identity = 65/101 (64.36%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Csa6G445100 vs. Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.8e-29 Identity = 68/103 (66.02%), Postives = 76/103 (73.79%), Query Frame = 1
BLAST of Csa6G445100 vs. Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.8e-29 Identity = 66/107 (61.68%), Postives = 73/107 (68.22%), Query Frame = 1
BLAST of Csa6G445100 vs. TrEMBL
Match: A0A0A0KEN2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G445100 PE=3 SV=1) HSP 1 Score: 221.5 bits (563), Expect = 5.0e-55 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Csa6G445100 vs. TrEMBL
Match: M5WC90_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa009689mg PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.0e-31 Identity = 70/99 (70.71%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of Csa6G445100 vs. TrEMBL
Match: A4UR73_9ROSA (Aquaporin PIP2 OS=Prunus humilis GN=pip2 PE=3 SV=2) HSP 1 Score: 141.4 bits (355), Expect = 6.6e-31 Identity = 70/99 (70.71%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of Csa6G445100 vs. TrEMBL
Match: A0A0S2PIB5_9ROSA (Aquaporin (Fragment) OS=Malus zumi GN=PIP2;1 PE=2 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.6e-31 Identity = 70/99 (70.71%), Postives = 77/99 (77.78%), Query Frame = 1
BLAST of Csa6G445100 vs. TrEMBL
Match: A0A0U2X1B7_9ROSA (Aquaporin PIP 2.3 OS=Prunus cerasifera x Prunus munsoniana PE=2 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 8.6e-31 Identity = 69/99 (69.70%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of Csa6G445100 vs. TAIR10
Match: AT2G37180.1 (AT2G37180.1 Aquaporin-like superfamily protein) HSP 1 Score: 132.1 bits (331), Expect = 2.0e-31 Identity = 67/101 (66.34%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Csa6G445100 vs. TAIR10
Match: AT5G60660.1 (AT5G60660.1 plasma membrane intrinsic protein 2;4) HSP 1 Score: 131.3 bits (329), Expect = 3.5e-31 Identity = 70/105 (66.67%), Postives = 75/105 (71.43%), Query Frame = 1
BLAST of Csa6G445100 vs. TAIR10
Match: AT2G37170.1 (AT2G37170.1 plasma membrane intrinsic protein 2) HSP 1 Score: 130.6 bits (327), Expect = 5.9e-31 Identity = 65/101 (64.36%), Postives = 74/101 (73.27%), Query Frame = 1
BLAST of Csa6G445100 vs. TAIR10
Match: AT3G53420.1 (AT3G53420.1 plasma membrane intrinsic protein 2A) HSP 1 Score: 129.8 bits (325), Expect = 1.0e-30 Identity = 68/103 (66.02%), Postives = 76/103 (73.79%), Query Frame = 1
BLAST of Csa6G445100 vs. TAIR10
Match: AT3G54820.1 (AT3G54820.1 plasma membrane intrinsic protein 2;5) HSP 1 Score: 122.9 bits (307), Expect = 1.2e-28 Identity = 62/92 (67.39%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of Csa6G445100 vs. NCBI nr
Match: gi|700192941|gb|KGN48145.1| (hypothetical protein Csa_6G445100 [Cucumis sativus]) HSP 1 Score: 221.5 bits (563), Expect = 7.2e-55 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Csa6G445100 vs. NCBI nr
Match: gi|778717077|ref|XP_004143247.2| (PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]) HSP 1 Score: 199.1 bits (505), Expect = 3.8e-48 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of Csa6G445100 vs. NCBI nr
Match: gi|659096733|ref|XP_008449258.1| (PREDICTED: aquaporin PIP2-2-like [Cucumis melo]) HSP 1 Score: 194.5 bits (493), Expect = 9.4e-47 Identity = 93/95 (97.89%), Postives = 93/95 (97.89%), Query Frame = 1
BLAST of Csa6G445100 vs. NCBI nr
Match: gi|595827182|ref|XP_007205689.1| (hypothetical protein PRUPE_ppa009689mg [Prunus persica]) HSP 1 Score: 144.1 bits (362), Expect = 1.5e-31 Identity = 70/99 (70.71%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of Csa6G445100 vs. NCBI nr
Match: gi|148467570|gb|ABO69705.2| (aquaporin PIP2 [Prunus humilis]) HSP 1 Score: 141.4 bits (355), Expect = 9.5e-31 Identity = 70/99 (70.71%), Postives = 78/99 (78.79%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |