MELO3C014243 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTAAGGATCTTGATCCTGGTTTTCCCACCGGCGACTACTTCGATCATCCTCCGGCTCCCTTCTTCGACTCTGAAGAGCTCTTGCGGTGGTCCTTTTATAGGGCTGTTATTGCCGAGTTCATTGCTACTCTTTTGTTTTTGTATGTTGGAGTTCTTACTGTGATCGGAAGCCAAAGTCAGGATTCTGCCGCGGTATGCGGCGGCGTTGGTGTTCAAGGTATTGCTTGGGCGTTCGGCGGCACCATCTTTGTTCTCGTTTACTGCACCGCCGGCATTTCTGGCAAGTTCTTCTAA ATGTCTAAGGATCTTGATCCTGGTTTTCCCACCGGCGACTACTTCGATCATCCTCCGGCTCCCTTCTTCGACTCTGAAGAGCTCTTGCGGTGGTCCTTTTATAGGGCTGTTATTGCCGAGTTCATTGCTACTCTTTTGTTTTTGTATGTTGGAGTTCTTACTGTGATCGGAAGCCAAAGTCAGGATTCTGCCGCGGTATGCGGCGGCGTTGGTGTTCAAGGTATTGCTTGGGCGTTCGGCGGCACCATCTTTGTTCTCGTTTACTGCACCGCCGGCATTTCTGGCAAGTTCTTCTAA ATGTCTAAGGATCTTGATCCTGGTTTTCCCACCGGCGACTACTTCGATCATCCTCCGGCTCCCTTCTTCGACTCTGAAGAGCTCTTGCGGTGGTCCTTTTATAGGGCTGTTATTGCCGAGTTCATTGCTACTCTTTTGTTTTTGTATGTTGGAGTTCTTACTGTGATCGGAAGCCAAAGTCAGGATTCTGCCGCGGTATGCGGCGGCGTTGGTGTTCAAGGTATTGCTTGGGCGTTCGGCGGCACCATCTTTGTTCTCGTTTACTGCACCGCCGGCATTTCTGGCAAGTTCTTCTAA MSKDLDPGFPTGDYFDHPPAPFFDSEELLRWSFYRAVIAEFIATLLFLYVGVLTVIGSQSQDSAAVCGGVGVQGIAWAFGGTIFVLVYCTAGISGKFF*
BLAST of MELO3C014243 vs. Swiss-Prot
Match: PIP23_ARATH (Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.9e-31 Identity = 68/101 (67.33%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of MELO3C014243 vs. Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2) HSP 1 Score: 133.7 bits (335), Expect = 1.1e-30 Identity = 66/101 (65.35%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of MELO3C014243 vs. Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.9e-30 Identity = 69/103 (66.99%), Postives = 77/103 (74.76%), Query Frame = 1
BLAST of MELO3C014243 vs. Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.9e-30 Identity = 70/103 (67.96%), Postives = 75/103 (72.82%), Query Frame = 1
BLAST of MELO3C014243 vs. Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 8.2e-29 Identity = 66/107 (61.68%), Postives = 72/107 (67.29%), Query Frame = 1
BLAST of MELO3C014243 vs. TrEMBL
Match: A0A0A0KEN2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G445100 PE=3 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 3.2e-48 Identity = 95/98 (96.94%), Postives = 95/98 (96.94%), Query Frame = 1
BLAST of MELO3C014243 vs. TrEMBL
Match: A4UR73_9ROSA (Aquaporin PIP2 OS=Prunus humilis GN=pip2 PE=3 SV=2) HSP 1 Score: 140.6 bits (353), Expect = 1.0e-30 Identity = 69/99 (69.70%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of MELO3C014243 vs. TrEMBL
Match: Q2Z1Z2_PRUMU (Aquaporin OS=Prunus mume GN=Pm3 PE=2 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.4e-30 Identity = 68/99 (68.69%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of MELO3C014243 vs. TrEMBL
Match: A0A0U2X1B7_9ROSA (Aquaporin PIP 2.3 OS=Prunus cerasifera x Prunus munsoniana PE=2 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.4e-30 Identity = 68/99 (68.69%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of MELO3C014243 vs. TrEMBL
Match: M5WC90_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa009689mg PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.3e-30 Identity = 68/99 (68.69%), Postives = 77/99 (77.78%), Query Frame = 1
BLAST of MELO3C014243 vs. TAIR10
Match: AT2G37180.1 (AT2G37180.1 Aquaporin-like superfamily protein) HSP 1 Score: 135.2 bits (339), Expect = 2.2e-32 Identity = 68/101 (67.33%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of MELO3C014243 vs. TAIR10
Match: AT2G37170.1 (AT2G37170.1 plasma membrane intrinsic protein 2) HSP 1 Score: 133.7 bits (335), Expect = 6.4e-32 Identity = 66/101 (65.35%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of MELO3C014243 vs. TAIR10
Match: AT3G53420.1 (AT3G53420.1 plasma membrane intrinsic protein 2A) HSP 1 Score: 132.9 bits (333), Expect = 1.1e-31 Identity = 69/103 (66.99%), Postives = 77/103 (74.76%), Query Frame = 1
BLAST of MELO3C014243 vs. TAIR10
Match: AT5G60660.1 (AT5G60660.1 plasma membrane intrinsic protein 2;4) HSP 1 Score: 132.9 bits (333), Expect = 1.1e-31 Identity = 70/103 (67.96%), Postives = 75/103 (72.82%), Query Frame = 1
BLAST of MELO3C014243 vs. TAIR10
Match: AT3G54820.1 (AT3G54820.1 plasma membrane intrinsic protein 2;5) HSP 1 Score: 123.2 bits (308), Expect = 8.7e-29 Identity = 62/91 (68.13%), Postives = 68/91 (74.73%), Query Frame = 1
BLAST of MELO3C014243 vs. NCBI nr
Match: gi|700192941|gb|KGN48145.1| (hypothetical protein Csa_6G445100 [Cucumis sativus]) HSP 1 Score: 198.7 bits (504), Expect = 4.6e-48 Identity = 95/98 (96.94%), Postives = 95/98 (96.94%), Query Frame = 1
BLAST of MELO3C014243 vs. NCBI nr
Match: gi|659096733|ref|XP_008449258.1| (PREDICTED: aquaporin PIP2-2-like [Cucumis melo]) HSP 1 Score: 198.7 bits (504), Expect = 4.6e-48 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 1
BLAST of MELO3C014243 vs. NCBI nr
Match: gi|778717077|ref|XP_004143247.2| (PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 8.7e-47 Identity = 93/95 (97.89%), Postives = 93/95 (97.89%), Query Frame = 1
BLAST of MELO3C014243 vs. NCBI nr
Match: gi|148467570|gb|ABO69705.2| (aquaporin PIP2 [Prunus humilis]) HSP 1 Score: 140.6 bits (353), Expect = 1.5e-30 Identity = 69/99 (69.70%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of MELO3C014243 vs. NCBI nr
Match: gi|961454922|gb|ALS31086.1| (aquaporin PIP 2.3 [Prunus cerasifera x Prunus munsoniana]) HSP 1 Score: 140.2 bits (352), Expect = 1.9e-30 Identity = 68/99 (68.69%), Postives = 78/99 (78.79%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|