Csa6G081490 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.AACAACTTTCAAAGTTAGGGTTTTGACCCTCCATAATCAGCAACTACGCGGCAGTCTCTGTTCTGCCACCAAAATGGTACCTCTCAATTTCTAATCCTTGATTGAATTTTTTTTCTATTGTTCATTTTCTTAATGCATTTCGGATTCAACCTACTTTTGAATTCTTATGTTTGCTGTCGCCGATTTTTTATCTGCCCTGAATTAGCTTCTGTTCTATTTAGTTGAACGTTGTGAGGGTGCATATCATCATTTAATTTTCTATTCTCGTTGCAATTCTATGGGTTTCTTGTGTTTTTGTTGGTAAACGTTTATGCGGATTTAATAACCGTAATGTACATGTTTTCATCTCGTTTGGATATCTTATGCTTTAGGTTATTTTGAAATTAATCAAATTGTGTCTTCTTGTTCCATATTTGGATTTGCAGCCGAAACAAATTCATGAGATCAAAGATTTCCTTCTCACTGCTAGAAGGAAGGATGCTCGTTCTGTGAAAATTAAGAGGAGCAAGGATGTTGTGAAGTTCAAAGTTCGATGCTCCAAATATCTTTATACTCTTTGTGTTTTCGACTCTGAGAAGGCAGACAAGTTGAAGCAATCCCTTCCACCAGGTTAG ATGCCGAAACAAATTCATGAGATCAAAGATTTCCTTCTCACTGCTAGAAGGAAGGATGCTCGTTCTGTGAAAATTAAGAGGAGCAAGGATGTTGTGAAGTTCAAAGTTCGATGCTCCAAATATCTTTATACTCTTTGTGTTTTCGACTCTGAGAAGGCAGACAAGTTGAAGCAATCCCTTCCACCAGGTTAG ATGCCGAAACAAATTCATGAGATCAAAGATTTCCTTCTCACTGCTAGAAGGAAGGATGCTCGTTCTGTGAAAATTAAGAGGAGCAAGGATGTTGTGAAGTTCAAAGTTCGATGCTCCAAATATCTTTATACTCTTTGTGTTTTCGACTCTGAGAAGGCAGACAAGTTGAAGCAATCCCTTCCACCAGGTTAG MPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKYLYTLCVFDSEKADKLKQSLPPG*
BLAST of Csa6G081490 vs. Swiss-Prot
Match: RL38_ARATH (60S ribosomal protein L38 OS=Arabidopsis thaliana GN=RPL38A PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.5e-28 Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa6G081490 vs. Swiss-Prot
Match: RL38_SOLLC (60S ribosomal protein L38 OS=Solanum lycopersicum GN=RPL38 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 1.9e-26 Identity = 57/63 (90.48%), Postives = 59/63 (93.65%), Query Frame = 1
BLAST of Csa6G081490 vs. Swiss-Prot
Match: RL38_BRABE (60S ribosomal protein L38 OS=Branchiostoma belcheri GN=RPL38 PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-24 Identity = 54/63 (85.71%), Postives = 57/63 (90.48%), Query Frame = 1
BLAST of Csa6G081490 vs. Swiss-Prot
Match: RL38_BOVIN (60S ribosomal protein L38 OS=Bos taurus GN=RPL38 PE=3 SV=4) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-22 Identity = 50/63 (79.37%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Csa6G081490 vs. Swiss-Prot
Match: RL38_HUMAN (60S ribosomal protein L38 OS=Homo sapiens GN=RPL38 PE=1 SV=2) HSP 1 Score: 105.5 bits (262), Expect = 2.2e-22 Identity = 50/63 (79.37%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Csa6G081490 vs. TrEMBL
Match: V7BWX3_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_005G154400g PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.0e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. TrEMBL
Match: A0A068VBT7_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00007069001 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.0e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. TrEMBL
Match: A0A0B2RCI9_GLYSO (60S ribosomal protein L38 OS=Glycine soja GN=glysoja_010467 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.0e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. TrEMBL
Match: D7SPL7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_04s0023g00930 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.0e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. TrEMBL
Match: A0A067K3R2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_18058 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.0e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. TAIR10
Match: AT2G43460.1 (AT2G43460.1 Ribosomal L38e protein family) HSP 1 Score: 125.9 bits (315), Expect = 8.7e-30 Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa6G081490 vs. TAIR10
Match: AT3G59540.1 (AT3G59540.1 Ribosomal L38e protein family) HSP 1 Score: 125.9 bits (315), Expect = 8.7e-30 Identity = 60/63 (95.24%), Postives = 60/63 (95.24%), Query Frame = 1
BLAST of Csa6G081490 vs. NCBI nr
Match: gi|802724650|ref|XP_012085801.1| (PREDICTED: 60S ribosomal protein L38 [Jatropha curcas]) HSP 1 Score: 129.0 bits (323), Expect = 2.9e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. NCBI nr
Match: gi|700191104|gb|KGN46308.1| (hypothetical protein Csa_6G081490 [Cucumis sativus]) HSP 1 Score: 129.0 bits (323), Expect = 2.9e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. NCBI nr
Match: gi|297735234|emb|CBI17596.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 129.0 bits (323), Expect = 2.9e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. NCBI nr
Match: gi|629123314|gb|KCW87739.1| (hypothetical protein EUGRSUZ_A00108, partial [Eucalyptus grandis]) HSP 1 Score: 129.0 bits (323), Expect = 2.9e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Csa6G081490 vs. NCBI nr
Match: gi|695075758|ref|XP_009385129.1| (PREDICTED: 60S ribosomal protein L38 [Musa acuminata subsp. malaccensis]) HSP 1 Score: 129.0 bits (323), Expect = 2.9e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|