Csa6G022340 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GAGAATAAGAAATTAGAGAACGCTGGAATTAAGTAATGGCGAAAACAAAATTGAGTGTCATGGTGGTAGTGCTGGCGGTGGCTTTGGTGGCTTTGGTGGAAGGATATGGGGGGAGAGTAGGAGGAAGGATGGAGGTTAAAGACGTGAGGAGGAACGAGGAGGTGCAGCGATTAGGAAGATTCAGCGTGGAGGAGTACAATCGTAGGATGGGAGGCGGGGGAGAGGTGAAGTTCACGGCGGTAGTTGCGGCGGAGAGGCAAGTGGTGTCGGGAACGAAATACTATTTGAGAATTTTGGGGACTCAAAATGGGGAGAGGAAAGTTTTTGATTCGGTTGTGATTGTGAAGCCTTGGATTGGTTCTAAGCGCCTTCTCGACTTTTCTCCTTCCGCAGTTTTTAGAACTCCCATTTTTAATTTTTGATTTCTTTTTTTTTCTTATTTTCTTGGGAAAATGGAGTTTTCTTTTCTTTCTCAGAGTTGTGAAGCAGAAGAGGAGCTGTAAATTTTTCTTCTTTCTTCCCAGTGAGCAATAAGAAATAAGTATGAGTTTAAA ATGGCGAAAACAAAATTGAGTGTCATGGTGGTAGTGCTGGCGGTGGCTTTGGTGGCTTTGGTGGAAGGATATGGGGGGAGAGTAGGAGGAAGGATGGAGGTTAAAGACGTGAGGAGGAACGAGGAGGTGCAGCGATTAGGAAGATTCAGCGTGGAGGAGTACAATCGTAGGATGGGAGGCGGGGGAGAGGTGAAGTTCACGGCGGTAGTTGCGGCGGAGAGGCAAGTGGTGTCGGGAACGAAATACTATTTGAGAATTTTGGGGACTCAAAATGGGGAGAGGAAAGTTTTTGATTCGGTTGTGATTGTGAAGCCTTGGATTGGTTCTAAGCGCCTTCTCGACTTTTCTCCTTCCGCAGTTTTTAGAACTCCCATTTTTAATTTTTGA ATGGCGAAAACAAAATTGAGTGTCATGGTGGTAGTGCTGGCGGTGGCTTTGGTGGCTTTGGTGGAAGGATATGGGGGGAGAGTAGGAGGAAGGATGGAGGTTAAAGACGTGAGGAGGAACGAGGAGGTGCAGCGATTAGGAAGATTCAGCGTGGAGGAGTACAATCGTAGGATGGGAGGCGGGGGAGAGGTGAAGTTCACGGCGGTAGTTGCGGCGGAGAGGCAAGTGGTGTCGGGAACGAAATACTATTTGAGAATTTTGGGGACTCAAAATGGGGAGAGGAAAGTTTTTGATTCGGTTGTGATTGTGAAGCCTTGGATTGGTTCTAAGCGCCTTCTCGACTTTTCTCCTTCCGCAGTTTTTAGAACTCCCATTTTTAATTTTTGA MAKTKLSVMVVVLAVALVALVEGYGGRVGGRMEVKDVRRNEEVQRLGRFSVEEYNRRMGGGGEVKFTAVVAAERQVVSGTKYYLRILGTQNGERKVFDSVVIVKPWIGSKRLLDFSPSAVFRTPIFNF*
BLAST of Csa6G022340 vs. Swiss-Prot
Match: CYT4_ORYSJ (Cysteine proteinase inhibitor 4 OS=Oryza sativa subsp. japonica GN=Os01g0915200 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 3.0e-23 Identity = 60/108 (55.56%), Postives = 73/108 (67.59%), Query Frame = 1
BLAST of Csa6G022340 vs. Swiss-Prot
Match: CYTB_HELAN (Cysteine proteinase inhibitor B OS=Helianthus annuus PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.9e-20 Identity = 50/97 (51.55%), Postives = 70/97 (72.16%), Query Frame = 1
BLAST of Csa6G022340 vs. Swiss-Prot
Match: CYT5_ORYSJ (Cysteine proteinase inhibitor 5 OS=Oryza sativa subsp. japonica GN=Os01g0915401 PE=3 SV=2) HSP 1 Score: 97.1 bits (240), Expect = 1.5e-19 Identity = 51/100 (51.00%), Postives = 65/100 (65.00%), Query Frame = 1
BLAST of Csa6G022340 vs. Swiss-Prot
Match: CYT2_ARATH (Cysteine proteinase inhibitor 2 OS=Arabidopsis thaliana GN=CYS2 PE=2 SV=2) HSP 1 Score: 89.7 bits (221), Expect = 2.5e-17 Identity = 51/136 (37.50%), Postives = 83/136 (61.03%), Query Frame = 1
BLAST of Csa6G022340 vs. Swiss-Prot
Match: CYT10_ORYSJ (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. japonica GN=Os04g0350100 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 5.5e-17 Identity = 48/110 (43.64%), Postives = 66/110 (60.00%), Query Frame = 1
BLAST of Csa6G022340 vs. TrEMBL
Match: A0A0A0KC20_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_6G022340 PE=3 SV=1) HSP 1 Score: 250.4 bits (638), Expect = 1.2e-63 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
BLAST of Csa6G022340 vs. TrEMBL
Match: A0A059VDR2_9ROSA (Cysteine proteinase inhibitor OS=Malus prunifolia PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 2.0e-26 Identity = 62/118 (52.54%), Postives = 87/118 (73.73%), Query Frame = 1
BLAST of Csa6G022340 vs. TrEMBL
Match: Q84XY6_MALDO (Cysteine proteinase inhibitor OS=Malus domestica PE=2 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 2.0e-26 Identity = 62/118 (52.54%), Postives = 87/118 (73.73%), Query Frame = 1
BLAST of Csa6G022340 vs. TrEMBL
Match: A0A058ZX43_EUCGR (Cysteine proteinase inhibitor OS=Eucalyptus grandis GN=EUGRSUZ_L00642 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.7e-25 Identity = 69/124 (55.65%), Postives = 85/124 (68.55%), Query Frame = 1
BLAST of Csa6G022340 vs. TrEMBL
Match: A0A061EJ89_THECC (Cysteine proteinase inhibitor OS=Theobroma cacao GN=TCM_020180 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.7e-25 Identity = 65/125 (52.00%), Postives = 89/125 (71.20%), Query Frame = 1
BLAST of Csa6G022340 vs. TAIR10
Match: AT2G31980.1 (AT2G31980.1 PHYTOCYSTATIN 2) HSP 1 Score: 89.7 bits (221), Expect = 1.4e-18 Identity = 51/136 (37.50%), Postives = 83/136 (61.03%), Query Frame = 1
BLAST of Csa6G022340 vs. TAIR10
Match: AT5G47550.1 (AT5G47550.1 Cystatin/monellin superfamily protein) HSP 1 Score: 67.8 bits (164), Expect = 5.7e-12 Identity = 41/119 (34.45%), Postives = 63/119 (52.94%), Query Frame = 1
BLAST of Csa6G022340 vs. TAIR10
Match: AT3G12490.2 (AT3G12490.2 cystatin B) HSP 1 Score: 64.7 bits (156), Expect = 4.8e-11 Identity = 33/92 (35.87%), Postives = 58/92 (63.04%), Query Frame = 1
BLAST of Csa6G022340 vs. TAIR10
Match: AT2G40880.1 (AT2G40880.1 cystatin A) HSP 1 Score: 60.5 bits (145), Expect = 9.0e-10 Identity = 29/92 (31.52%), Postives = 55/92 (59.78%), Query Frame = 1
BLAST of Csa6G022340 vs. TAIR10
Match: AT5G05110.1 (AT5G05110.1 Cystatin/monellin family protein) HSP 1 Score: 53.9 bits (128), Expect = 8.4e-08 Identity = 38/134 (28.36%), Postives = 68/134 (50.75%), Query Frame = 1
BLAST of Csa6G022340 vs. NCBI nr
Match: gi|449441532|ref|XP_004138536.1| (PREDICTED: cysteine proteinase inhibitor B [Cucumis sativus]) HSP 1 Score: 250.4 bits (638), Expect = 1.7e-63 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
BLAST of Csa6G022340 vs. NCBI nr
Match: gi|659131010|ref|XP_008465470.1| (PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]) HSP 1 Score: 224.9 bits (572), Expect = 7.8e-56 Identity = 112/128 (87.50%), Postives = 119/128 (92.97%), Query Frame = 1
BLAST of Csa6G022340 vs. NCBI nr
Match: gi|657953919|ref|XP_008365221.1| (PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]) HSP 1 Score: 126.7 bits (317), Expect = 2.9e-26 Identity = 62/118 (52.54%), Postives = 87/118 (73.73%), Query Frame = 1
BLAST of Csa6G022340 vs. NCBI nr
Match: gi|694396663|ref|XP_009373605.1| (PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]) HSP 1 Score: 126.3 bits (316), Expect = 3.8e-26 Identity = 62/118 (52.54%), Postives = 86/118 (72.88%), Query Frame = 1
BLAST of Csa6G022340 vs. NCBI nr
Match: gi|694391102|ref|XP_009371093.1| (PREDICTED: cysteine proteinase inhibitor B [Pyrus x bretschneideri]) HSP 1 Score: 125.6 bits (314), Expect = 6.5e-26 Identity = 62/118 (52.54%), Postives = 86/118 (72.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|