Carg04920 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGAAAGCAAGGCTCTCTCTGATCGCCGTCGTGGTGCTGGCGCTGCTGGAGGTGGCGATTCTGGCGGAAGGATACAGCGGAAGAATAGGCGGACGAAGAAGAATCAAAGACGTGAGGAGCAACGAGGAGGTGCAGGGATTAGGGAGGTTCAGCGTGGAGGAGTACAATCGGAGATCGCGGCGGAGTGGAGGCGGAGAGGTGAAGTTCTTGGCGGTGTTGGTGGCGGAGAGGCAGGTGGTGGCCGGAACGAAGTATTACTTGAGGATCTTGGGGATTGAGAACGGTCGGAAGAGGATTTTTGAATCGGTTGTGGTCGTGAAGCCGTGGCTAAGGTCTAAGCAGCTTATCGATTTCTCGGCGTCGAGATTGTTTCCGAGTAGGATTTCAAATTTCTGA ATGACGAAAGCAAGGCTCTCTCTGATCGCCGTCGTGGTGCTGGCGCTGCTGGAGGTGGCGATTCTGGCGGAAGGATACAGCGGAAGAATAGGCGGACGAAGAAGAATCAAAGACGTGAGGAGCAACGAGGAGGTGCAGGGATTAGGGAGGTTCAGCGTGGAGGAGTACAATCGGAGATCGCGGCGGAGTGGAGGCGGAGAGGTGAAGTTCTTGGCGGTGTTGGTGGCGGAGAGGCAGGTGGTGGCCGGAACGAAGTATTACTTGAGGATCTTGGGGATTGAGAACGGTCGGAAGAGGATTTTTGAATCGGTTGTGGTCGTGAAGCCGTGGCTAAGGTCTAAGCAGCTTATCGATTTCTCGGCGTCGAGATTGTTTCCGAGTAGGATTTCAAATTTCTGA ATGACGAAAGCAAGGCTCTCTCTGATCGCCGTCGTGGTGCTGGCGCTGCTGGAGGTGGCGATTCTGGCGGAAGGATACAGCGGAAGAATAGGCGGACGAAGAAGAATCAAAGACGTGAGGAGCAACGAGGAGGTGCAGGGATTAGGGAGGTTCAGCGTGGAGGAGTACAATCGGAGATCGCGGCGGAGTGGAGGCGGAGAGGTGAAGTTCTTGGCGGTGTTGGTGGCGGAGAGGCAGGTGGTGGCCGGAACGAAGTATTACTTGAGGATCTTGGGGATTGAGAACGGTCGGAAGAGGATTTTTGAATCGGTTGTGGTCGTGAAGCCGTGGCTAAGGTCTAAGCAGCTTATCGATTTCTCGGCGTCGAGATTGTTTCCGAGTAGGATTTCAAATTTCTGA MTKARLSLIAVVVLALLEVAILAEGYSGRIGGRRRIKDVRSNEEVQGLGRFSVEEYNRRSRRSGGGEVKFLAVLVAERQVVAGTKYYLRILGIENGRKRIFESVVVVKPWLRSKQLIDFSASRLFPSRISNF
BLAST of Carg04920 vs. NCBI nr
Match: XP_022960190.1 (cysteine proteinase inhibitor B [Cucurbita moschata]) HSP 1 Score: 241.9 bits (616), Expect = 1.2e-60 Identity = 129/132 (97.73%), Postives = 131/132 (99.24%), Query Frame = 0
BLAST of Carg04920 vs. NCBI nr
Match: XP_023513886.1 (cysteine proteinase inhibitor B [Cucurbita pepo subsp. pepo]) HSP 1 Score: 240.0 bits (611), Expect = 4.7e-60 Identity = 128/132 (96.97%), Postives = 129/132 (97.73%), Query Frame = 0
BLAST of Carg04920 vs. NCBI nr
Match: XP_023005096.1 (cysteine proteinase inhibitor B-like [Cucurbita maxima]) HSP 1 Score: 231.9 bits (590), Expect = 1.3e-57 Identity = 122/132 (92.42%), Postives = 130/132 (98.48%), Query Frame = 0
BLAST of Carg04920 vs. NCBI nr
Match: XP_004138536.1 (PREDICTED: cysteine proteinase inhibitor B [Cucumis sativus] >KGN45922.1 Cystatin [Cucumis sativus]) HSP 1 Score: 160.6 bits (405), Expect = 3.6e-36 Identity = 87/132 (65.91%), Postives = 105/132 (79.55%), Query Frame = 0
BLAST of Carg04920 vs. NCBI nr
Match: XP_008465470.1 (PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]) HSP 1 Score: 155.6 bits (392), Expect = 1.2e-34 Identity = 80/132 (60.61%), Postives = 104/132 (78.79%), Query Frame = 0
BLAST of Carg04920 vs. TAIR10
Match: AT2G31980.1 (PHYTOCYSTATIN 2) HSP 1 Score: 79.3 bits (194), Expect = 1.9e-15 Identity = 50/130 (38.46%), Postives = 81/130 (62.31%), Query Frame = 0
BLAST of Carg04920 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-10 Identity = 35/102 (34.31%), Postives = 64/102 (62.75%), Query Frame = 0
BLAST of Carg04920 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 61.2 bits (147), Expect = 5.4e-10 Identity = 31/93 (33.33%), Postives = 57/93 (61.29%), Query Frame = 0
BLAST of Carg04920 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 5.4e-10 Identity = 43/122 (35.25%), Postives = 73/122 (59.84%), Query Frame = 0
BLAST of Carg04920 vs. TAIR10
Match: AT5G05110.1 (Cystatin/monellin family protein) HSP 1 Score: 57.8 bits (138), Expect = 6.0e-09 Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = 0
BLAST of Carg04920 vs. Swiss-Prot
Match: sp|Q5N806|CYT4_ORYSJ (Cysteine proteinase inhibitor 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915200 PE=2 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.0e-18 Identity = 51/107 (47.66%), Postives = 70/107 (65.42%), Query Frame = 0
BLAST of Carg04920 vs. Swiss-Prot
Match: sp|Q10993|CYTB_HELAN (Cysteine proteinase inhibitor B OS=Helianthus annuus OX=4232 PE=1 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 4.0e-18 Identity = 45/92 (48.91%), Postives = 71/92 (77.17%), Query Frame = 0
BLAST of Carg04920 vs. Swiss-Prot
Match: sp|A2XS65|CYT10_ORYSI (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_014908 PE=3 SV=2) HSP 1 Score: 86.7 bits (213), Expect = 2.2e-16 Identity = 47/107 (43.93%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Carg04920 vs. Swiss-Prot
Match: sp|P0C579|CYT10_ORYSJ (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0350100 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.2e-16 Identity = 47/107 (43.93%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Carg04920 vs. Swiss-Prot
Match: sp|Q8L5T9|CYT2_ARATH (Cysteine proteinase inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=CYS2 PE=2 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 3.5e-14 Identity = 50/130 (38.46%), Postives = 81/130 (62.31%), Query Frame = 0
BLAST of Carg04920 vs. TrEMBL
Match: tr|A0A0A0KC20|A0A0A0KC20_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G022340 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.4e-36 Identity = 87/132 (65.91%), Postives = 105/132 (79.55%), Query Frame = 0
BLAST of Carg04920 vs. TrEMBL
Match: tr|A0A1S3CPD1|A0A1S3CPD1_CUCME (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103503076 PE=3 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 7.7e-35 Identity = 80/132 (60.61%), Postives = 104/132 (78.79%), Query Frame = 0
BLAST of Carg04920 vs. TrEMBL
Match: tr|A0A218XH41|A0A218XH41_PUNGR (Cysteine proteinase inhibitor OS=Punica granatum OX=22663 GN=CDL15_Pgr011629 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 8.5e-26 Identity = 68/124 (54.84%), Postives = 92/124 (74.19%), Query Frame = 0
BLAST of Carg04920 vs. TrEMBL
Match: tr|A0A059VDR2|A0A059VDR2_9ROSA (Cysteine proteinase inhibitor OS=Malus prunifolia OX=106564 PE=2 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 4.7e-24 Identity = 58/115 (50.43%), Postives = 86/115 (74.78%), Query Frame = 0
BLAST of Carg04920 vs. TrEMBL
Match: tr|Q84XY6|Q84XY6_MALDO (Cysteine proteinase inhibitor OS=Malus domestica OX=3750 PE=2 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 4.7e-24 Identity = 58/115 (50.43%), Postives = 86/115 (74.78%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|