Csa2G292820 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AGAAATAAAAAAAAAATGGAGGGACGCGTAGGGAAGGAGTGAAGAGGTGGGCATTGATTAACCACAGCTGTACTCCAATCACACTCTCACTCTCTTCTCCTCCATCTTCATGTGACATTCATCTCTCTCTCTCTAAACCCCCCCATCTCCTCCTTCTCTCCCTTCCCCAAATCTCCAATGGCTTCCAAATCCCTCCTCTTCCCCCTCTTCACCCTCCTCCTCCTCTTCCTCTCTTCCTCCTCCGCCCACCTCTCCGTCGACACCTCCCTCAAACTCATGGCCGACGCCCTCGAATGGCCCACCACCACTTCCCTCATCCAATCCCCCACTGAAGACGACCTCGACGACGATCTCGACCTACAACAAGACCCCCGCAGATCTCTCTTCTGGAGGCGAGTCCACTACTACATTTCCTACGGTGCCCTCTCCGCCAACCGGATCCCTTGCCCACCCCGCTCCGGCCGCCCTTACTACACTCATAACTGCTACAAAGCTCGTGGCCCTGTCAATCCTTACACCCGCGGCTGCTCCGCCATCACTCGCTGCCGCCGCTGATCTCTCTCTCTCTCTCTTGTAAAACCCCGTCGTATCCCCCCTCTACTCCGAATTTCTTCCTCTCCTCTTTGTTTTGTCGTTTTTTTTTTAGTGCCTTGGAGTTCGACAACGGAGACGACATGTAGTTTTGGGGATTTCCTTATTTTATATTACTTTTTTGTTTATTGTTCCGCAATCTAGGGTCCGGAAAACGACGTGGTTTTGTTGGTTGGCTATTTAATTATGATAATGATGTGTACTTTTATATCTGAACAAGATTATATAAATTCAAGATTGTTTTATCATTATCATTACTTCCTAATTATATTTTAATCATAGATTGATGCTCTAATTAC ATGGCTTCCAAATCCCTCCTCTTCCCCCTCTTCACCCTCCTCCTCCTCTTCCTCTCTTCCTCCTCCGCCCACCTCTCCGTCGACACCTCCCTCAAACTCATGGCCGACGCCCTCGAATGGCCCACCACCACTTCCCTCATCCAATCCCCCACTGAAGACGACCTCGACGACGATCTCGACCTACAACAAGACCCCCGCAGATCTCTCTTCTGGAGGCGAGTCCACTACTACATTTCCTACGGTGCCCTCTCCGCCAACCGGATCCCTTGCCCACCCCGCTCCGGCCGCCCTTACTACACTCATAACTGCTACAAAGCTCGTGGCCCTGTCAATCCTTACACCCGCGGCTGCTCCGCCATCACTCGCTGCCGCCGCTGA ATGGCTTCCAAATCCCTCCTCTTCCCCCTCTTCACCCTCCTCCTCCTCTTCCTCTCTTCCTCCTCCGCCCACCTCTCCGTCGACACCTCCCTCAAACTCATGGCCGACGCCCTCGAATGGCCCACCACCACTTCCCTCATCCAATCCCCCACTGAAGACGACCTCGACGACGATCTCGACCTACAACAAGACCCCCGCAGATCTCTCTTCTGGAGGCGAGTCCACTACTACATTTCCTACGGTGCCCTCTCCGCCAACCGGATCCCTTGCCCACCCCGCTCCGGCCGCCCTTACTACACTCATAACTGCTACAAAGCTCGTGGCCCTGTCAATCCTTACACCCGCGGCTGCTCCGCCATCACTCGCTGCCGCCGCTGA MASKSLLFPLFTLLLLFLSSSSAHLSVDTSLKLMADALEWPTTTSLIQSPTEDDLDDDLDLQQDPRRSLFWRRVHYYISYGALSANRIPCPPRSGRPYYTHNCYKARGPVNPYTRGCSAITRCRR*
BLAST of Csa2G292820 vs. Swiss-Prot
Match: RLF34_ARATH (Protein RALF-like 34 OS=Arabidopsis thaliana GN=RALFL34 PE=2 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.5e-32 Identity = 72/130 (55.38%), Postives = 88/130 (67.69%), Query Frame = 1
BLAST of Csa2G292820 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.0e-08 Identity = 38/74 (51.35%), Postives = 43/74 (58.11%), Query Frame = 1
BLAST of Csa2G292820 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 7.8e-08 Identity = 34/74 (45.95%), Postives = 43/74 (58.11%), Query Frame = 1
BLAST of Csa2G292820 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.0e-07 Identity = 30/49 (61.22%), Postives = 31/49 (63.27%), Query Frame = 1
BLAST of Csa2G292820 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.0e-07 Identity = 32/69 (46.38%), Postives = 39/69 (56.52%), Query Frame = 1
BLAST of Csa2G292820 vs. TrEMBL
Match: A0A0A0LMS2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G292820 PE=4 SV=1) HSP 1 Score: 261.9 bits (668), Expect = 3.9e-67 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
BLAST of Csa2G292820 vs. TrEMBL
Match: I1LHE0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_11G055200 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 4.7e-36 Identity = 81/122 (66.39%), Postives = 95/122 (77.87%), Query Frame = 1
BLAST of Csa2G292820 vs. TrEMBL
Match: V7CF83_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_002G018200g PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 4.0e-35 Identity = 81/127 (63.78%), Postives = 95/127 (74.80%), Query Frame = 1
BLAST of Csa2G292820 vs. TrEMBL
Match: W9R4K2_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_011056 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 8.9e-35 Identity = 85/129 (65.89%), Postives = 91/129 (70.54%), Query Frame = 1
BLAST of Csa2G292820 vs. TrEMBL
Match: I3SH61_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 1.2e-34 Identity = 79/126 (62.70%), Postives = 93/126 (73.81%), Query Frame = 1
BLAST of Csa2G292820 vs. TAIR10
Match: AT5G67070.1 (AT5G67070.1 ralf-like 34) HSP 1 Score: 139.0 bits (349), Expect = 1.9e-33 Identity = 72/130 (55.38%), Postives = 88/130 (67.69%), Query Frame = 1
BLAST of Csa2G292820 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-09 Identity = 38/74 (51.35%), Postives = 43/74 (58.11%), Query Frame = 1
BLAST of Csa2G292820 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 58.2 bits (139), Expect = 4.4e-09 Identity = 34/74 (45.95%), Postives = 43/74 (58.11%), Query Frame = 1
BLAST of Csa2G292820 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 57.8 bits (138), Expect = 5.7e-09 Identity = 30/49 (61.22%), Postives = 31/49 (63.27%), Query Frame = 1
BLAST of Csa2G292820 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-06 Identity = 40/121 (33.06%), Postives = 53/121 (43.80%), Query Frame = 1
BLAST of Csa2G292820 vs. NCBI nr
Match: gi|449460676|ref|XP_004148071.1| (PREDICTED: protein RALF-like 34 [Cucumis sativus]) HSP 1 Score: 261.9 bits (668), Expect = 5.7e-67 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
BLAST of Csa2G292820 vs. NCBI nr
Match: gi|659116040|ref|XP_008457868.1| (PREDICTED: protein RALF-like 34 [Cucumis melo]) HSP 1 Score: 255.4 bits (651), Expect = 5.3e-65 Identity = 122/125 (97.60%), Postives = 124/125 (99.20%), Query Frame = 1
BLAST of Csa2G292820 vs. NCBI nr
Match: gi|743817338|ref|XP_010930902.1| (PREDICTED: protein RALF-like 34 [Elaeis guineensis]) HSP 1 Score: 161.0 bits (406), Expect = 1.4e-36 Identity = 79/129 (61.24%), Postives = 96/129 (74.42%), Query Frame = 1
BLAST of Csa2G292820 vs. NCBI nr
Match: gi|1009144459|ref|XP_015889813.1| (PREDICTED: protein RALF-like 34 [Ziziphus jujuba]) HSP 1 Score: 158.7 bits (400), Expect = 6.7e-36 Identity = 81/116 (69.83%), Postives = 90/116 (77.59%), Query Frame = 1
BLAST of Csa2G292820 vs. NCBI nr
Match: gi|356541805|ref|XP_003539363.1| (PREDICTED: protein RALF-like 34 [Glycine max]) HSP 1 Score: 158.7 bits (400), Expect = 6.7e-36 Identity = 81/122 (66.39%), Postives = 95/122 (77.87%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|