Csa1G532280 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAAGCATCATCCTGATTTGATCATGTGCAGAAAGCAGCCAGGAATTGCAATTGGCCGCCTATGTGAGAAGTGCGATGGGAAGTGTGTAATCTGTGATTCTTATGTCCGCCCCTGTACACTTGTTCGAGTTTGTGACGAATGCAATTACGGGTCTTTCCAAGGCCGTTGTGTGATCTGTGGAGGAGTAGGAATTTCAGATGCTTACTACTGCAAAGAGTGTACACAGCAGGAGAAAGATAGAGATGGATGCCCAAAGATTGTTAATTTAGGCAGTGCAAAAACAGATTTGTTCTATGAACGTAAGAAATATGGGTTCAAGAAACGATGA ATGGCCAAGCATCATCCTGATTTGATCATGTGCAGAAAGCAGCCAGGAATTGCAATTGGCCGCCTATGTGAGAAGTGCGATGGGAAGTGTGTAATCTGTGATTCTTATGTCCGCCCCTGTACACTTGTTCGAGTTTGTGACGAATGCAATTACGGGTCTTTCCAAGGCCGTTGTGTGATCTGTGGAGGAGTAGGAATTTCAGATGCTTACTACTGCAAAGAGTGTACACAGCAGGAGAAAGATAGAGATGGATGCCCAAAGATTGTTAATTTAGGCAGTGCAAAAACAGATTTGTTCTATGAACGTAAGAAATATGGGTTCAAGAAACGATGA ATGGCCAAGCATCATCCTGATTTGATCATGTGCAGAAAGCAGCCAGGAATTGCAATTGGCCGCCTATGTGAGAAGTGCGATGGGAAGTGTGTAATCTGTGATTCTTATGTCCGCCCCTGTACACTTGTTCGAGTTTGTGACGAATGCAATTACGGGTCTTTCCAAGGCCGTTGTGTGATCTGTGGAGGAGTAGGAATTTCAGATGCTTACTACTGCAAAGAGTGTACACAGCAGGAGAAAGATAGAGATGGATGCCCAAAGATTGTTAATTTAGGCAGTGCAAAAACAGATTTGTTCTATGAACGTAAGAAATATGGGTTCAAGAAACGATGA MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRVCDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR*
BLAST of Csa1G532280 vs. Swiss-Prot
Match: PHF5A_ARATH (PHD finger-like domain-containing protein 5A OS=Arabidopsis thaliana GN=At2g30000 PE=3 SV=1) HSP 1 Score: 245.0 bits (624), Expect = 3.9e-64 Identity = 109/110 (99.09%), Postives = 108/110 (98.18%), Query Frame = 1
BLAST of Csa1G532280 vs. Swiss-Prot
Match: PHF5B_ARATH (PHD finger-like domain-containing protein 5B OS=Arabidopsis thaliana GN=At1g07170 PE=2 SV=1) HSP 1 Score: 245.0 bits (624), Expect = 3.9e-64 Identity = 109/110 (99.09%), Postives = 108/110 (98.18%), Query Frame = 1
BLAST of Csa1G532280 vs. Swiss-Prot
Match: PHF5A_HUMAN (PHD finger-like domain-containing protein 5A OS=Homo sapiens GN=PHF5A PE=1 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 4.5e-60 Identity = 101/110 (91.82%), Postives = 104/110 (94.55%), Query Frame = 1
BLAST of Csa1G532280 vs. Swiss-Prot
Match: PHF5A_MOUSE (PHD finger-like domain-containing protein 5A OS=Mus musculus GN=Phf5a PE=1 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 4.5e-60 Identity = 101/110 (91.82%), Postives = 104/110 (94.55%), Query Frame = 1
BLAST of Csa1G532280 vs. Swiss-Prot
Match: PHF5A_RAT (PHD finger-like domain-containing protein 5A OS=Rattus norvegicus GN=Phf5a PE=2 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 4.5e-60 Identity = 101/110 (91.82%), Postives = 104/110 (94.55%), Query Frame = 1
BLAST of Csa1G532280 vs. TrEMBL
Match: C6SXE4_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_11G173100 PE=2 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 3.4e-62 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. TrEMBL
Match: A0A0E0DJK7_9ORYZ (Uncharacterized protein OS=Oryza meridionalis PE=4 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 3.4e-62 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. TrEMBL
Match: A9P9G1_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s28430g PE=2 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 3.4e-62 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. TrEMBL
Match: A0A0K9Q643_ZOSMR (Pre-mRNA-splicing factor ini1 OS=Zostera marina GN=ZOSMA_105G00570 PE=4 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 3.4e-62 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. TrEMBL
Match: A0A0D3G1A3_9ORYZ (Uncharacterized protein OS=Oryza barthii PE=4 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 3.4e-62 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. TAIR10
Match: AT1G07170.1 (AT1G07170.1 PHF5-like protein) HSP 1 Score: 245.0 bits (624), Expect = 2.2e-65 Identity = 109/110 (99.09%), Postives = 108/110 (98.18%), Query Frame = 1
BLAST of Csa1G532280 vs. TAIR10
Match: AT2G30000.1 (AT2G30000.1 PHF5-like protein) HSP 1 Score: 245.0 bits (624), Expect = 2.2e-65 Identity = 109/110 (99.09%), Postives = 108/110 (98.18%), Query Frame = 1
BLAST of Csa1G532280 vs. NCBI nr
Match: gi|351720989|ref|NP_001235659.1| (uncharacterized protein LOC100305969 [Glycine max]) HSP 1 Score: 245.4 bits (625), Expect = 4.8e-62 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. NCBI nr
Match: gi|226494093|ref|NP_001152699.1| (PHD finger-like domain-containing protein 5A [Zea mays]) HSP 1 Score: 245.0 bits (624), Expect = 6.3e-62 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. NCBI nr
Match: gi|18390735|ref|NP_563782.1| (splicing factor 3b-like protein [Arabidopsis thaliana]) HSP 1 Score: 245.0 bits (624), Expect = 6.3e-62 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. NCBI nr
Match: gi|922467047|ref|XP_013633804.1| (PREDICTED: PHD finger-like domain-containing protein 5B [Brassica oleracea var. oleracea]) HSP 1 Score: 244.6 bits (623), Expect = 8.2e-62 Identity = 108/110 (98.18%), Postives = 110/110 (100.00%), Query Frame = 1
BLAST of Csa1G532280 vs. NCBI nr
Match: gi|685300614|ref|XP_009141029.1| (PREDICTED: PHD finger-like domain-containing protein 5B [Brassica rapa]) HSP 1 Score: 244.6 bits (623), Expect = 8.2e-62 Identity = 108/110 (98.18%), Postives = 110/110 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|