Csa1G120440 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAATCGGAAACCAATTCAGCTACAGCTTATCCGGAATACATATTACCATACTTGGTTCATGCTCTTGCTCATCATTCATGTCCAGATGTTGATGAATGCAAGGATGTCCAGGCATATGAACTAGTATATAGGTAAGCTTATATCTCAATATCACTTATATTTATTCGGTGGTATATATGTTAGAAAAGAGCTCAATGAGAAATATATATATATAGAACTAATAATATGCTGTAAATTTGGTAAGTTTAGAAAAGTATACCCATCCCTGTACATAAGTGGTTTAGTGAGATTGATTGCGAACTCTGTGTTGTTGAATTATTTATTTTTTATCTTTTTTTTTTTTTTGGTATTAAGTTTGATGAAAATTTTGTAAAGTTCGATGAAAATATTTGTAAAGATCTGCAAATATAGACATGAAGCCATTTTGGTGTTTGGCTGTTTGTTTTGGTTGCGTTCTCATTTTCTTTAACTGCAGGAAAATATACCCATTAAAGAGGTTTTATGAAAATCTGAGATGTAGCAAAGAGGGTCTTACCAGTGAGGCTGCCGAGGAAAGGCTGAAGATTTTTAGTGACGATAAGCTTGAGGAAAAGAAGTTAATGCTTCACTTACTAGTAGCATTGCGATTAACTCAGTTAGTTTTTCAGGTAACGCTTCATACAATTGACTTTGCCAGATGCTCATGA ATGCAATCGGAAACCAATTCAGCTACAGCTTATCCGGAATACATATTACCATACTTGGTTCATGCTCTTGCTCATCATTCATGTCCAGATGTTGATGAATGCAAGGATGTCCAGGCATATGAACTAGTATATAGGAAAATATACCCATTAAAGAGGTTTTATGAAAATCTGAGATGTAGCAAAGAGGGTCTTACCAGTGAGGCTGCCGAGGAAAGGCTGAAGATTTTTAGTGACGATAAGCTTGAGGAAAAGAAGTTAATGCTTCACTTACTAGTAGCATTGCGATTAACTCAGTTAGTTTTTCAGGTAACGCTTCATACAATTGACTTTGCCAGATGCTCATGA ATGCAATCGGAAACCAATTCAGCTACAGCTTATCCGGAATACATATTACCATACTTGGTTCATGCTCTTGCTCATCATTCATGTCCAGATGTTGATGAATGCAAGGATGTCCAGGCATATGAACTAGTATATAGGAAAATATACCCATTAAAGAGGTTTTATGAAAATCTGAGATGTAGCAAAGAGGGTCTTACCAGTGAGGCTGCCGAGGAAAGGCTGAAGATTTTTAGTGACGATAAGCTTGAGGAAAAGAAGTTAATGCTTCACTTACTAGTAGCATTGCGATTAACTCAGTTAGTTTTTCAGGTAACGCTTCATACAATTGACTTTGCCAGATGCTCATGA MQSETNSATAYPEYILPYLVHALAHHSCPDVDECKDVQAYELVYRKIYPLKRFYENLRCSKEGLTSEAAEERLKIFSDDKLEEKKLMLHLLVALRLTQLVFQVTLHTIDFARCS*
BLAST of Csa1G120440 vs. Swiss-Prot
Match: PMA4_ARATH (ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 3.5e-07 Identity = 24/37 (64.86%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Csa1G120440 vs. Swiss-Prot
Match: PMA11_ARATH (ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.5e-07 Identity = 27/56 (48.21%), Postives = 37/56 (66.07%), Query Frame = 1
BLAST of Csa1G120440 vs. Swiss-Prot
Match: PMA3_NICPL (Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.0e-07 Identity = 28/53 (52.83%), Postives = 34/53 (64.15%), Query Frame = 1
BLAST of Csa1G120440 vs. Swiss-Prot
Match: PMA1_NICPL (Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 7.8e-07 Identity = 28/53 (52.83%), Postives = 34/53 (64.15%), Query Frame = 1
BLAST of Csa1G120440 vs. Swiss-Prot
Match: PMA1_SOLLC (Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 1
BLAST of Csa1G120440 vs. TrEMBL
Match: A0A0A0LSQ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G120440 PE=4 SV=1) HSP 1 Score: 232.6 bits (592), Expect = 2.3e-58 Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Csa1G120440 vs. TrEMBL
Match: A0A0A0LW18_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G172630 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 9.9e-17 Identity = 52/113 (46.02%), Postives = 69/113 (61.06%), Query Frame = 1
BLAST of Csa1G120440 vs. TrEMBL
Match: W9QL19_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_010621 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.4e-15 Identity = 43/74 (58.11%), Postives = 54/74 (72.97%), Query Frame = 1
BLAST of Csa1G120440 vs. TrEMBL
Match: A0A061GGJ0_THECC (Androgen induced inhibitor of proliferation / pds5 isoform 1 OS=Theobroma cacao GN=TCM_030447 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.2e-15 Identity = 36/48 (75.00%), Postives = 46/48 (95.83%), Query Frame = 1
BLAST of Csa1G120440 vs. TrEMBL
Match: A0A061GHF7_THECC (Androgen induced inhibitor of proliferation / pds5 isoform 2 OS=Theobroma cacao GN=TCM_030447 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.2e-15 Identity = 36/48 (75.00%), Postives = 46/48 (95.83%), Query Frame = 1
BLAST of Csa1G120440 vs. TAIR10
Match: AT5G47690.3 (AT5G47690.3 binding) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-16 Identity = 37/71 (52.11%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of Csa1G120440 vs. TAIR10
Match: AT3G47950.1 (AT3G47950.1 H(+)-ATPase 4) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-08 Identity = 24/37 (64.86%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Csa1G120440 vs. TAIR10
Match: AT5G62670.1 (AT5G62670.1 H(+)-ATPase 11) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-08 Identity = 27/56 (48.21%), Postives = 37/56 (66.07%), Query Frame = 1
BLAST of Csa1G120440 vs. TAIR10
Match: AT4G30190.2 (AT4G30190.2 H(+)-ATPase 2) HSP 1 Score: 47.4 bits (111), Expect = 7.0e-06 Identity = 18/37 (48.65%), Postives = 29/37 (78.38%), Query Frame = 1
BLAST of Csa1G120440 vs. NCBI nr
Match: gi|700209732|gb|KGN64828.1| (hypothetical protein Csa_1G120440 [Cucumis sativus]) HSP 1 Score: 232.6 bits (592), Expect = 3.4e-58 Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Csa1G120440 vs. NCBI nr
Match: gi|659127303|ref|XP_008463634.1| (PREDICTED: LOW QUALITY PROTEIN: sister chromatid cohesion protein PDS5 homolog A [Cucumis melo]) HSP 1 Score: 99.0 bits (245), Expect = 5.8e-18 Identity = 56/113 (49.56%), Postives = 69/113 (61.06%), Query Frame = 1
BLAST of Csa1G120440 vs. NCBI nr
Match: gi|778659626|ref|XP_011654769.1| (PREDICTED: sister chromatid cohesion protein PDS5 homolog A isoform X2 [Cucumis sativus]) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 52/113 (46.02%), Postives = 69/113 (61.06%), Query Frame = 1
BLAST of Csa1G120440 vs. NCBI nr
Match: gi|700209896|gb|KGN64992.1| (hypothetical protein Csa_1G172630 [Cucumis sativus]) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 52/113 (46.02%), Postives = 69/113 (61.06%), Query Frame = 1
BLAST of Csa1G120440 vs. NCBI nr
Match: gi|778659622|ref|XP_011654767.1| (PREDICTED: sister chromatid cohesion protein PDS5 homolog A isoform X1 [Cucumis sativus]) HSP 1 Score: 94.4 bits (233), Expect = 1.4e-16 Identity = 52/113 (46.02%), Postives = 69/113 (61.06%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|