Csa1G015720 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGGATGGGTGTGAACCTGGGATTAAAACATATGATCTATTGATGGGAAAACTTTGTGCCCACAATCGTTTGGACAAAGCGAATTCACTCTTTAACGAAGCTCAAAAACGGGGTGTACCAGTTACTCCAAAAGCATATCAGGTGGATCCGAAATATGTAAAGAAGCCAAAGGATAAGAAGGTTGCAAAGAAGAGGGAGACATTGCCAGAGAAAATGGCGAGAAAGAGGCGACGACTGAAGCAAATTCGATTGAGTTTTGTCAAGAAACCGAGAAGAGGAATGCGTAGAGCATTTTGA ATGAAGAAGGATGGGTGTGAACCTGGGATTAAAACATATGATCTATTGATGGGAAAACTTTGTGCCCACAATCGTTTGGACAAAGCGAATTCACTCTTTAACGAAGCTCAAAAACGGGGTGTACCAGTTACTCCAAAAGCATATCAGGTGGATCCGAAATATGTAAAGAAGCCAAAGGATAAGAAGGTTGCAAAGAAGAGGGAGACATTGCCAGAGAAAATGGCGAGAAAGAGGCGACGACTGAAGCAAATTCGATTGAGTTTTGTCAAGAAACCGAGAAGAGGAATGCGTAGAGCATTTTGA ATGAAGAAGGATGGGTGTGAACCTGGGATTAAAACATATGATCTATTGATGGGAAAACTTTGTGCCCACAATCGTTTGGACAAAGCGAATTCACTCTTTAACGAAGCTCAAAAACGGGGTGTACCAGTTACTCCAAAAGCATATCAGGTGGATCCGAAATATGTAAAGAAGCCAAAGGATAAGAAGGTTGCAAAGAAGAGGGAGACATTGCCAGAGAAAATGGCGAGAAAGAGGCGACGACTGAAGCAAATTCGATTGAGTTTTGTCAAGAAACCGAGAAGAGGAATGCGTAGAGCATTTTGA MKKDGCEPGIKTYDLLMGKLCAHNRLDKANSLFNEAQKRGVPVTPKAYQVDPKYVKKPKDKKVAKKRETLPEKMARKRRRLKQIRLSFVKKPRRGMRRAF*
BLAST of Csa1G015720 vs. Swiss-Prot
Match: PP438_ARATH (Pentatricopeptide repeat-containing protein PNM1, mitochondrial OS=Arabidopsis thaliana GN=PNM1 PE=1 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.2e-30 Identity = 65/101 (64.36%), Postives = 81/101 (80.20%), Query Frame = 1
BLAST of Csa1G015720 vs. TrEMBL
Match: A0A0A0LPN9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G015720 PE=4 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 2.7e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa1G015720 vs. TrEMBL
Match: A0A059A5E5_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_K02538 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 6.2e-39 Identity = 80/97 (82.47%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa1G015720 vs. TrEMBL
Match: D7SIL7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_17s0000g05090 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 3.8e-36 Identity = 78/100 (78.00%), Postives = 89/100 (89.00%), Query Frame = 1
BLAST of Csa1G015720 vs. TrEMBL
Match: M5WCV0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa004540mg PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 4.9e-36 Identity = 77/101 (76.24%), Postives = 89/101 (88.12%), Query Frame = 1
BLAST of Csa1G015720 vs. TrEMBL
Match: W9QEE5_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_016828 PE=4 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 8.4e-36 Identity = 78/101 (77.23%), Postives = 88/101 (87.13%), Query Frame = 1
BLAST of Csa1G015720 vs. TAIR10
Match: AT5G60960.1 (AT5G60960.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 133.7 bits (335), Expect = 6.6e-32 Identity = 65/101 (64.36%), Postives = 81/101 (80.20%), Query Frame = 1
BLAST of Csa1G015720 vs. NCBI nr
Match: gi|449440893|ref|XP_004138218.1| (PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 3.9e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa1G015720 vs. NCBI nr
Match: gi|700208682|gb|KGN63778.1| (hypothetical protein Csa_1G015720 [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 3.9e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa1G015720 vs. NCBI nr
Match: gi|659106304|ref|XP_008453300.1| (PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Cucumis melo]) HSP 1 Score: 198.7 bits (504), Expect = 4.7e-48 Identity = 96/100 (96.00%), Postives = 99/100 (99.00%), Query Frame = 1
BLAST of Csa1G015720 vs. NCBI nr
Match: gi|702496510|ref|XP_010037251.1| (PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Eucalyptus grandis]) HSP 1 Score: 167.9 bits (424), Expect = 8.9e-39 Identity = 80/97 (82.47%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Csa1G015720 vs. NCBI nr
Match: gi|743887753|ref|XP_011038239.1| (PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Populus euphratica]) HSP 1 Score: 165.6 bits (418), Expect = 4.4e-38 Identity = 80/99 (80.81%), Postives = 87/99 (87.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |