CsGy1G009720 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GTGACATATCCATTAGAAGTTTTGAGGTTACACATGGCAGTTGACCCTGGGTTTCGAGCAACATCCAAGGTTTGTTTACTTTTGCCCTACCTATATCTGAAAATTGAAAAACCAATCATCAATTGTACTTTAGTATGGACAATTATTGGTTTCTAGATTGCCTCAAGTATGCTACGAGAGGAAGGCATTACATCTTTTACTACAGTGGTCTTGGACCGTCTCTTTTCTGCAGAGCTCCTTACATTGCCTGTTGTGAACCTTTGCATTTTTCACTTATAG GTGACATATCCATTAGAAGTTTTGAGGTTACACATGGCAGTTGACCCTGGGTTTCGAGCAACATCCAAGATTGCCTCAAGTATGCTACGAGAGGAAGGCATTACATCTTTTACTACAGTGGTCTTGGACCGTCTCTTTTCTGCAGAGCTCCTTACATTGCCTGTTGTGAACCTTTGCATTTTTCACTTATAG GTGACATATCCATTAGAAGTTTTGAGGTTACACATGGCAGTTGACCCTGGGTTTCGAGCAACATCCAAGATTGCCTCAAGTATGCTACGAGAGGAAGGCATTACATCTTTTACTACAGTGGTCTTGGACCGTCTCTTTTCTGCAGAGCTCCTTACATTGCCTGTTGTGAACCTTTGCATTTTTCACTTATAG VTYPLEVLRLHMAVDPGFRATSKIASSMLREEGITSFTTVVLDRLFSAELLTLPVVNLCIFHL
BLAST of CsGy1G009720 vs. NCBI nr
Match: KGN64423.1 (hypothetical protein Csa_1G051610 [Cucumis sativus]) HSP 1 Score: 107.1 bits (266), Expect = 2.3e-20 Identity = 56/62 (90.32%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of CsGy1G009720 vs. NCBI nr
Match: XP_008442426.1 (PREDICTED: probable envelope ADP,ATP carrier protein, chloroplastic isoform X1 [Cucumis melo] >ADN33798.1 ADPATP carrier protein [Cucumis melo subsp. melo]) HSP 1 Score: 65.5 bits (158), Expect = 7.5e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. NCBI nr
Match: XP_004137723.1 (PREDICTED: probable envelope ADP,ATP carrier protein, chloroplastic isoform X1 [Cucumis sativus] >KGN58762.1 hypothetical protein Csa_3G731730 [Cucumis sativus]) HSP 1 Score: 65.5 bits (158), Expect = 7.5e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. NCBI nr
Match: XP_011651862.1 (PREDICTED: probable envelope ADP,ATP carrier protein, chloroplastic isoform X2 [Cucumis sativus]) HSP 1 Score: 65.5 bits (158), Expect = 7.5e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. NCBI nr
Match: XP_016899747.1 (PREDICTED: probable envelope ADP,ATP carrier protein, chloroplastic isoform X2 [Cucumis melo]) HSP 1 Score: 65.5 bits (158), Expect = 7.5e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. TAIR10
Match: AT5G01500.1 (thylakoid ATP/ADP carrier) HSP 1 Score: 56.2 bits (134), Expect = 8.3e-09 Identity = 29/63 (46.03%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of CsGy1G009720 vs. TAIR10
Match: AT3G51870.1 (Mitochondrial substrate carrier family protein) HSP 1 Score: 53.9 bits (128), Expect = 4.1e-08 Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of CsGy1G009720 vs. Swiss-Prot
Match: sp|Q9M024|TAAC_ARATH (Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TAAC PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-07 Identity = 29/63 (46.03%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of CsGy1G009720 vs. Swiss-Prot
Match: sp|O65023|EAAC_ARATH (Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EAAC PE=2 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 7.4e-07 Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 0
BLAST of CsGy1G009720 vs. TrEMBL
Match: tr|A0A0A0LRL6|A0A0A0LRL6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G051610 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.5e-20 Identity = 56/62 (90.32%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of CsGy1G009720 vs. TrEMBL
Match: tr|A0A1S4DUT0|A0A1S4DUT0_CUCME (probable envelope ADP,ATP carrier protein, chloroplastic isoform X2 OS=Cucumis melo OX=3656 GN=LOC103486300 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.0e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. TrEMBL
Match: tr|A0A1S3B567|A0A1S3B567_CUCME (probable envelope ADP,ATP carrier protein, chloroplastic isoform X1 OS=Cucumis melo OX=3656 GN=LOC103486300 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.0e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. TrEMBL
Match: tr|E5GBF7|E5GBF7_CUCME (ADPATP carrier protein OS=Cucumis melo subsp. melo OX=412675 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.0e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsGy1G009720 vs. TrEMBL
Match: tr|A0A0A0LDF0|A0A0A0LDF0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G731730 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.0e-08 Identity = 38/63 (60.32%), Postives = 44/63 (69.84%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |