Cp4.1LG20g04050 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCCGTAGATTTTACAAGGGCGAGATCAGCGGAATGAAAGATCCGACGGCGAAGCGTGAGCCGATATTGAAGGCGGTGAGAGATCATTCGGGATCATCTTCGAATCAGGGGGCAAGGGGATTTTACAGTGGTATGGATTCGAGTGCGGTAATGGCTGCGAAGGCGGAGAAACTTAAGCGGGCCGAGGAGTCTCTCAGAACGGTTATGTATTTGAGCTGTTGGGGGCCTAACTAA ATGAGCCGTAGATTTTACAAGGGCGAGATCAGCGGAATGAAAGATCCGACGGCGAAGCGTGAGCCGATATTGAAGGCGGTGAGAGATCATTCGGGATCATCTTCGAATCAGGGGGCAAGGGGATTTTACAGTGGTATGGATTCGAGTGCGGTAATGGCTGCGAAGGCGGAGAAACTTAAGCGGGCCGAGGAGTCTCTCAGAACGGTTATGTATTTGAGCTGTTGGGGGCCTAACTAA ATGAGCCGTAGATTTTACAAGGGCGAGATCAGCGGAATGAAAGATCCGACGGCGAAGCGTGAGCCGATATTGAAGGCGGTGAGAGATCATTCGGGATCATCTTCGAATCAGGGGGCAAGGGGATTTTACAGTGGTATGGATTCGAGTGCGGTAATGGCTGCGAAGGCGGAGAAACTTAAGCGGGCCGAGGAGTCTCTCAGAACGGTTATGTATTTGAGCTGTTGGGGGCCTAACTAA MSRRFYKGEISGMKDPTAKREPILKAVRDHSGSSSNQGARGFYSGMDSSAVMAAKAEKLKRAEESLRTVMYLSCWGPN
BLAST of Cp4.1LG20g04050 vs. TrEMBL
Match: B9H210_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s03330g PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.9e-11 Identity = 40/70 (57.14%), Postives = 52/70 (74.29%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. TrEMBL
Match: Q6YCG3_VITVI (Wound induced protein-like (Fragment) OS=Vitis vinifera GN=WIP PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.7e-10 Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. TrEMBL
Match: A0A022QKW0_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a018114mg PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.0e-09 Identity = 40/82 (48.78%), Postives = 59/82 (71.95%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. TrEMBL
Match: A0A0A0LV05_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G071850 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.8e-09 Identity = 42/77 (54.55%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. TrEMBL
Match: V4UE40_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10017323mg PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.7e-09 Identity = 34/68 (50.00%), Postives = 51/68 (75.00%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. TAIR10
Match: AT4G10270.1 (AT4G10270.1 Wound-responsive family protein) HSP 1 Score: 56.6 bits (135), Expect = 7.9e-09 Identity = 32/76 (42.11%), Postives = 46/76 (60.53%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. TAIR10
Match: AT4G05070.1 (AT4G05070.1 Wound-responsive family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.5e-07 Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. NCBI nr
Match: gi|224076777|ref|XP_002304995.1| (hypothetical protein POPTR_0004s03330g [Populus trichocarpa]) HSP 1 Score: 76.3 bits (186), Expect = 2.7e-11 Identity = 40/70 (57.14%), Postives = 52/70 (74.29%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. NCBI nr
Match: gi|37724583|gb|AAO12870.1| (wound induced protein-like, partial [Vitis vinifera]) HSP 1 Score: 72.4 bits (176), Expect = 3.9e-10 Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. NCBI nr
Match: gi|359495702|ref|XP_003635065.1| (PREDICTED: uncharacterized protein LOC100233117 [Vitis vinifera]) HSP 1 Score: 72.4 bits (176), Expect = 3.9e-10 Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. NCBI nr
Match: gi|604315182|gb|EYU27888.1| (hypothetical protein MIMGU_mgv1a018114mg [Erythranthe guttata]) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-09 Identity = 40/82 (48.78%), Postives = 59/82 (71.95%), Query Frame = 1
BLAST of Cp4.1LG20g04050 vs. NCBI nr
Match: gi|659067929|ref|XP_008441945.1| (PREDICTED: transcription factor MafB-like [Cucumis melo]) HSP 1 Score: 70.1 bits (170), Expect = 2.0e-09 Identity = 41/78 (52.56%), Postives = 49/78 (62.82%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |