Cp4.1LG17g02320 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTCTCGAGGTAATAAGCGGCCTTCTATTACTAATGGTGATGATAATTTAGGCGTCTTGTCTAGGGTTTCCCGTTCTGTCTCCGATTCCCAAATCGTGCAGCGGGCGAAAAGTACGGCTTCTGATGCCGCATTCGTCTCCCAAAAGCTTCTTCGTAGCACCGGTAAAGCTGCGTGGATTGCAGGGACGACTTTTCTCATCTTGGTGGTGCCGCTCATCATTGAAATGGATCGCGAACAGCAGTTCAATGAGCTTGAGATGCAGCAGGCGAGTTTACTTGGTGCTCCAGCCACCGCTGCTCCGAAATGA ATGGCGTCTCGAGGTAATAAGCGGCCTTCTATTACTAATGGTGATGATAATTTAGGCGTCTTGTCTAGGGTTTCCCGTTCTGTCTCCGATTCCCAAATCGTGCAGCGGGCGAAAAGTACGGCTTCTGATGCCGCATTCGTCTCCCAAAAGCTTCTTCGTAGCACCGGTAAAGCTGCGTGGATTGCAGGGACGACTTTTCTCATCTTGGTGGTGCCGCTCATCATTGAAATGGATCGCGAACAGCAGTTCAATGAGCTTGAGATGCAGCAGGCGAGTTTACTTGGTGCTCCAGCCACCGCTGCTCCGAAATGA ATGGCGTCTCGAGGTAATAAGCGGCCTTCTATTACTAATGGTGATGATAATTTAGGCGTCTTGTCTAGGGTTTCCCGTTCTGTCTCCGATTCCCAAATCGTGCAGCGGGCGAAAAGTACGGCTTCTGATGCCGCATTCGTCTCCCAAAAGCTTCTTCGTAGCACCGGTAAAGCTGCGTGGATTGCAGGGACGACTTTTCTCATCTTGGTGGTGCCGCTCATCATTGAAATGGATCGCGAACAGCAGTTCAATGAGCTTGAGATGCAGCAGGCGAGTTTACTTGGTGCTCCAGCCACCGCTGCTCCGAAATGA MASRGNKRPSITNGDDNLGVLSRVSRSVSDSQIVQRAKSTASDAAFVSQKLLRSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEMQQASLLGAPATAAPK
BLAST of Cp4.1LG17g02320 vs. Swiss-Prot
Match: TOM92_ARATH (Mitochondrial import receptor subunit TOM9-2 OS=Arabidopsis thaliana GN=TOM9-2 PE=1 SV=3) HSP 1 Score: 102.8 bits (255), Expect = 2.2e-21 Identity = 58/84 (69.05%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. Swiss-Prot
Match: TOM91_ARATH (Mitochondrial import receptor subunit TOM9-1 OS=Arabidopsis thaliana GN=TOM9-1 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.8e-16 Identity = 42/80 (52.50%), Postives = 59/80 (73.75%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TrEMBL
Match: A0A0A0LNL3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G171830 PE=4 SV=1) HSP 1 Score: 181.8 bits (460), Expect = 4.2e-43 Identity = 97/103 (94.17%), Postives = 100/103 (97.09%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TrEMBL
Match: A0A067KB20_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_12866 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 4.3e-27 Identity = 67/97 (69.07%), Postives = 83/97 (85.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TrEMBL
Match: V4S9I2_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10006291mg PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.7e-26 Identity = 68/98 (69.39%), Postives = 77/98 (78.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TrEMBL
Match: A0A067DCT3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g034107mg PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.7e-26 Identity = 68/98 (69.39%), Postives = 77/98 (78.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TrEMBL
Match: D7U363_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_07s0005g04240 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 4.0e-25 Identity = 67/98 (68.37%), Postives = 77/98 (78.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TAIR10
Match: AT5G43970.1 (AT5G43970.1 translocase of outer membrane 22-V) HSP 1 Score: 102.8 bits (255), Expect = 1.3e-22 Identity = 58/84 (69.05%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. TAIR10
Match: AT1G04070.1 (AT1G04070.1 translocase of outer membrane 22-I) HSP 1 Score: 85.9 bits (211), Expect = 1.6e-17 Identity = 42/80 (52.50%), Postives = 59/80 (73.75%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. NCBI nr
Match: gi|659121501|ref|XP_008460691.1| (PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Cucumis melo]) HSP 1 Score: 181.8 bits (460), Expect = 6.1e-43 Identity = 97/103 (94.17%), Postives = 100/103 (97.09%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. NCBI nr
Match: gi|643724017|gb|KDP33317.1| (hypothetical protein JCGZ_12866 [Jatropha curcas]) HSP 1 Score: 128.6 bits (322), Expect = 6.1e-27 Identity = 67/97 (69.07%), Postives = 83/97 (85.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. NCBI nr
Match: gi|802633656|ref|XP_012077600.1| (PREDICTED: uncharacterized protein LOC105638417 [Jatropha curcas]) HSP 1 Score: 128.6 bits (322), Expect = 6.1e-27 Identity = 67/97 (69.07%), Postives = 83/97 (85.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. NCBI nr
Match: gi|567854443|ref|XP_006420341.1| (hypothetical protein CICLE_v10006291mg [Citrus clementina]) HSP 1 Score: 125.2 bits (313), Expect = 6.8e-26 Identity = 68/98 (69.39%), Postives = 77/98 (78.57%), Query Frame = 1
BLAST of Cp4.1LG17g02320 vs. NCBI nr
Match: gi|985465015|ref|XP_015389215.1| (PREDICTED: uncharacterized protein LOC102627797 isoform X4 [Citrus sinensis]) HSP 1 Score: 124.8 bits (312), Expect = 8.8e-26 Identity = 69/99 (69.70%), Postives = 79/99 (79.80%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|