Carg10112 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTCTCGGGGTAATAAGCGGCCTTCTATTACGGATGGCGATGAGAATTTAGGCGTTCTATCTAGGGTTTCTCGTTCCGTCTCTGATTCCCAAATCGTCCGGCGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACCCAAAAACTCCTCCGTAGTACTGGTAAAGCTGCGTGGATTGCAGGGACGACTTTTCTCATTTTGGTGGTGCCGCTCATCATTGAGATGGATCGCGAGCAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTCTACTTGGTACTCCGGCCACTGCTGCTCCTAAATGA ATGGCGTCTCGGGGTAATAAGCGGCCTTCTATTACGGATGGCGATGAGAATTTAGGCGTTCTATCTAGGGTTTCTCGTTCCGTCTCTGATTCCCAAATCGTCCGGCGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACCCAAAAACTCCTCCGTAGTACTGGTAAAGCTGCGTGGATTGCAGGGACGACTTTTCTCATTTTGGTGGTGCCGCTCATCATTGAGATGGATCGCGAGCAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTCTACTTGGTACTCCGGCCACTGCTGCTCCTAAATGA ATGGCGTCTCGGGGTAATAAGCGGCCTTCTATTACGGATGGCGATGAGAATTTAGGCGTTCTATCTAGGGTTTCTCGTTCCGTCTCTGATTCCCAAATCGTCCGGCGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACCCAAAAACTCCTCCGTAGTACTGGTAAAGCTGCGTGGATTGCAGGGACGACTTTTCTCATTTTGGTGGTGCCGCTCATCATTGAGATGGATCGCGAGCAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTCTACTTGGTACTCCGGCCACTGCTGCTCCTAAATGA MASRGNKRPSITDGDENLGVLSRVSRSVSDSQIVRRAKSTASDAAFVTQKLLRSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEMQQASLLGTPATAAPK
BLAST of Carg10112 vs. NCBI nr
Match: XP_022959104.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita moschata]) HSP 1 Score: 192.6 bits (488), Expect = 6.7e-46 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg10112 vs. NCBI nr
Match: XP_023006088.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita maxima]) HSP 1 Score: 192.6 bits (488), Expect = 6.7e-46 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg10112 vs. NCBI nr
Match: XP_023548768.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 192.6 bits (488), Expect = 6.7e-46 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of Carg10112 vs. NCBI nr
Match: XP_023514145.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 184.5 bits (467), Expect = 1.8e-43 Identity = 98/103 (95.15%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Carg10112 vs. NCBI nr
Match: XP_022138842.1 (mitochondrial import receptor subunit TOM9-2-like [Momordica charantia]) HSP 1 Score: 183.3 bits (464), Expect = 4.1e-43 Identity = 98/103 (95.15%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of Carg10112 vs. TAIR10
Match: AT5G43970.1 (translocase of outer membrane 22-V) HSP 1 Score: 100.1 bits (248), Expect = 8.2e-22 Identity = 56/84 (66.67%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Carg10112 vs. TAIR10
Match: AT1G04070.1 (translocase of outer membrane 22-I) HSP 1 Score: 86.3 bits (212), Expect = 1.2e-17 Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Carg10112 vs. Swiss-Prot
Match: sp|Q9FNC9|TOM92_ARATH (Mitochondrial import receptor subunit TOM9-2 OS=Arabidopsis thaliana OX=3702 GN=TOM9-2 PE=1 SV=3) HSP 1 Score: 100.1 bits (248), Expect = 1.5e-20 Identity = 56/84 (66.67%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Carg10112 vs. Swiss-Prot
Match: sp|O64497|TOM91_ARATH (Mitochondrial import receptor subunit TOM9-1 OS=Arabidopsis thaliana OX=3702 GN=TOM9-1 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.2e-16 Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Carg10112 vs. TrEMBL
Match: tr|A0A1S3CDH3|A0A1S3CDH3_CUCME (mitochondrial import receptor subunit TOM9-2-like OS=Cucumis melo OX=3656 GN=LOC103499459 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 1.0e-42 Identity = 96/103 (93.20%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of Carg10112 vs. TrEMBL
Match: tr|A0A0A0LNL3|A0A0A0LNL3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G171830 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 1.0e-42 Identity = 96/103 (93.20%), Postives = 101/103 (98.06%), Query Frame = 0
BLAST of Carg10112 vs. TrEMBL
Match: tr|A0A2R6Q1F7|A0A2R6Q1F7_ACTCH (Mitochondrial import receptor subunit TOM9-2 like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc24201 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.0e-26 Identity = 72/108 (66.67%), Postives = 85/108 (78.70%), Query Frame = 0
BLAST of Carg10112 vs. TrEMBL
Match: tr|A0A1U8AJL8|A0A1U8AJL8_NELNU (mitochondrial import receptor subunit TOM9-2-like OS=Nelumbo nucifera OX=4432 GN=LOC104600969 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 72/103 (69.90%), Postives = 81/103 (78.64%), Query Frame = 0
BLAST of Carg10112 vs. TrEMBL
Match: tr|A0A251UQZ2|A0A251UQZ2_HELAN (Putative translocase of outer membrane 22-V OS=Helianthus annuus OX=4232 GN=TOM22-V PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 3.9e-26 Identity = 66/85 (77.65%), Postives = 75/85 (88.24%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|