Bhi12G001381 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTCTCGGGGTAATAAGCGACCTTCTATCACCAATGGCGATGACAATTTAGGCGTCCTGTCTAGGGTTTCCCGTTCCGTTTCCGATTCCCAAATCGTCCGACGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACTCAAAAACTCCTCCGTAGCACCGGCAAAGCTGCTTGGATTGCTGGGACGACTTTTCTCATCTTGGTGGTGCCACTAATTATTGAGATGGATCGCGAACAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTTTACTTGGTACTCCGGCCACCGCCGCTTCTAAATGA ATGGCGTCTCGGGGTAATAAGCGACCTTCTATCACCAATGGCGATGACAATTTAGGCGTCCTGTCTAGGGTTTCCCGTTCCGTTTCCGATTCCCAAATCGTCCGACGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACTCAAAAACTCCTCCGTAGCACCGGCAAAGCTGCTTGGATTGCTGGGACGACTTTTCTCATCTTGGTGGTGCCACTAATTATTGAGATGGATCGCGAACAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTTTACTTGGTACTCCGGCCACCGCCGCTTCTAAATGA ATGGCGTCTCGGGGTAATAAGCGACCTTCTATCACCAATGGCGATGACAATTTAGGCGTCCTGTCTAGGGTTTCCCGTTCCGTTTCCGATTCCCAAATCGTCCGACGGGCGAAGAGCACAGCTTCCGACGCTGCCTTCGTTACTCAAAAACTCCTCCGTAGCACCGGCAAAGCTGCTTGGATTGCTGGGACGACTTTTCTCATCTTGGTGGTGCCACTAATTATTGAGATGGATCGCGAACAGCAGTTCAATGAGCTCGAGATGCAGCAGGCGAGTTTACTTGGTACTCCGGCCACCGCCGCTTCTAAATGA MASRGNKRPSITNGDDNLGVLSRVSRSVSDSQIVRRAKSTASDAAFVTQKLLRSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEMQQASLLGTPATAASK
BLAST of Bhi12G001381 vs. Swiss-Prot
Match: sp|Q9FNC9|TOM92_ARATH (Mitochondrial import receptor subunit TOM9-2 OS=Arabidopsis thaliana OX=3702 GN=TOM9-2 PE=1 SV=3) HSP 1 Score: 99.8 bits (247), Expect = 1.9e-20 Identity = 56/84 (66.67%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Bhi12G001381 vs. Swiss-Prot
Match: sp|O64497|TOM91_ARATH (Mitochondrial import receptor subunit TOM9-1 OS=Arabidopsis thaliana OX=3702 GN=TOM9-1 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.2e-16 Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Bhi12G001381 vs. Swiss-Prot
Match: sp|A6QPI6|TOM22_BOVIN (Mitochondrial import receptor subunit TOM22 homolog OS=Bos taurus OX=9913 GN=TOMM22 PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 7.4e-04 Identity = 26/70 (37.14%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of Bhi12G001381 vs. Swiss-Prot
Match: sp|Q9NS69|TOM22_HUMAN (Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3) HSP 1 Score: 44.7 bits (104), Expect = 7.4e-04 Identity = 26/70 (37.14%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of Bhi12G001381 vs. Swiss-Prot
Match: sp|Q4R3C7|TOM22_MACFA (Mitochondrial import receptor subunit TOM22 homolog OS=Macaca fascicularis OX=9541 GN=TOMM22 PE=2 SV=3) HSP 1 Score: 44.7 bits (104), Expect = 7.4e-04 Identity = 26/70 (37.14%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of Bhi12G001381 vs. TAIR10
Match: AT5G43970.1 (translocase of outer membrane 22-V) HSP 1 Score: 99.8 bits (247), Expect = 1.1e-21 Identity = 56/84 (66.67%), Postives = 67/84 (79.76%), Query Frame = 0
BLAST of Bhi12G001381 vs. TAIR10
Match: AT1G04070.1 (translocase of outer membrane 22-I) HSP 1 Score: 86.3 bits (212), Expect = 1.2e-17 Identity = 42/80 (52.50%), Postives = 60/80 (75.00%), Query Frame = 0
BLAST of Bhi12G001381 vs. TrEMBL
Match: tr|A0A1S3CDH3|A0A1S3CDH3_CUCME (mitochondrial import receptor subunit TOM9-2-like OS=Cucumis melo OX=3656 GN=LOC103499459 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 4.1e-44 Identity = 99/103 (96.12%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Bhi12G001381 vs. TrEMBL
Match: tr|A0A0A0LNL3|A0A0A0LNL3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G171830 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 4.1e-44 Identity = 99/103 (96.12%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Bhi12G001381 vs. TrEMBL
Match: tr|A0A067KB20|A0A067KB20_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_12866 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 3.0e-26 Identity = 67/103 (65.05%), Postives = 82/103 (79.61%), Query Frame = 0
BLAST of Bhi12G001381 vs. TrEMBL
Match: tr|A0A2R6Q1F7|A0A2R6Q1F7_ACTCH (Mitochondrial import receptor subunit TOM9-2 like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc24201 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 3.9e-26 Identity = 68/99 (68.69%), Postives = 82/99 (82.83%), Query Frame = 0
BLAST of Bhi12G001381 vs. TrEMBL
Match: tr|A0A1U8AJL8|A0A1U8AJL8_NELNU (mitochondrial import receptor subunit TOM9-2-like OS=Nelumbo nucifera OX=4432 GN=LOC104600969 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 3.9e-26 Identity = 71/103 (68.93%), Postives = 82/103 (79.61%), Query Frame = 0
BLAST of Bhi12G001381 vs. NCBI nr
Match: XP_008460691.1 (PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Cucumis melo] >XP_011649127.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Cucumis sativus] >KGN61561.1 hypothetical protein Csa_2G171830 [Cucumis sativus]) HSP 1 Score: 186.0 bits (471), Expect = 6.3e-44 Identity = 99/103 (96.12%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Bhi12G001381 vs. NCBI nr
Match: XP_022959104.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita moschata]) HSP 1 Score: 185.7 bits (470), Expect = 8.2e-44 Identity = 100/103 (97.09%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Bhi12G001381 vs. NCBI nr
Match: XP_023006088.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita maxima]) HSP 1 Score: 185.7 bits (470), Expect = 8.2e-44 Identity = 100/103 (97.09%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Bhi12G001381 vs. NCBI nr
Match: XP_023548768.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 185.7 bits (470), Expect = 8.2e-44 Identity = 100/103 (97.09%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of Bhi12G001381 vs. NCBI nr
Match: XP_023514145.1 (mitochondrial import receptor subunit TOM9-2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 184.1 bits (466), Expect = 2.4e-43 Identity = 99/103 (96.12%), Postives = 101/103 (98.06%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |