Cp4.1LG14g06110 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGTCAAGGGGTGTGATAGAGCCACTTATTGTGGGGAGAGTGGTGGGCGACGTGGTTGATTTGTTCTCTCCAAATGTGAAAATGAGTGTGGTTTACAACTCCACCAAACAAGTCGCCAATGGCCACGAGCTTCCCCCTTGTTTTGTTTCCTCTAAGCCACGCGTTGAGGTCGGTGGCGACGACATGAGATCGGCTTTCACTTTGGTATCTCATTTCCCCCGCCCTTCCTCGCTTCATTTCCTTTCATTTTAGTGTTTTAAGTAAGTAATTGGTTATGTTGTTAGATTATGATCGACCCAGATGCTCCAAGCCCGAGTGATCCTTTTCATAAGGAATACCTTCACTGGTTTGTGCTCTAA ATGATGGGTGTGATAGAGCCACTTATTGTGGGGAGAGTGGTGGGCGACGTGGTTGATTTGTTCTCTCCAAATGTGAAAATGAGTGTGGTTTACAACTCCACCAAACAAGTCGCCAATGGCCACGAGCTTCCCCCTTGTTTTGTTTCCTCTAAGCCACGCGTTGAGGTCGGTGGCGACGACATGAGATCGGCTTTCACTTTGATTATGATCGACCCAGATGCTCCAAGCCCGAGTGATCCTTTTCATAAGGAATACCTTCACTGGTTTGTGCTCTAA ATGATGGGTGTGATAGAGCCACTTATTGTGGGGAGAGTGGTGGGCGACGTGGTTGATTTGTTCTCTCCAAATGTGAAAATGAGTGTGGTTTACAACTCCACCAAACAAGTCGCCAATGGCCACGAGCTTCCCCCTTGTTTTGTTTCCTCTAAGCCACGCGTTGAGGTCGGTGGCGACGACATGAGATCGGCTTTCACTTTGATTATGATCGACCCAGATGCTCCAAGCCCGAGTGATCCTTTTCATAAGGAATACCTTCACTGGTTTGTGCTCTAA MMGVIEPLIVGRVVGDVVDLFSPNVKMSVVYNSTKQVANGHELPPCFVSSKPRVEVGGDDMRSAFTLIMIDPDAPSPSDPFHKEYLHWFVL
BLAST of Cp4.1LG14g06110 vs. Swiss-Prot
Match: CET1_TOBAC (CEN-like protein 1 OS=Nicotiana tabacum GN=CET1 PE=2 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.4e-30 Identity = 56/87 (64.37%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. Swiss-Prot
Match: CET4_TOBAC (CEN-like protein 4 OS=Nicotiana tabacum GN=CET4 PE=2 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.6e-29 Identity = 58/85 (68.24%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. Swiss-Prot
Match: TFL1_ARATH (Protein TERMINAL FLOWER 1 OS=Arabidopsis thaliana GN=TFL1 PE=1 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.4e-29 Identity = 62/87 (71.26%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. Swiss-Prot
Match: BFT_ARATH (Protein BROTHER of FT and TFL 1 OS=Arabidopsis thaliana GN=BFT PE=3 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.4e-29 Identity = 57/86 (66.28%), Postives = 72/86 (83.72%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. Swiss-Prot
Match: CET2_TOBAC (CEN-like protein 2 OS=Nicotiana tabacum GN=CET2 PE=2 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 4.4e-29 Identity = 57/85 (67.06%), Postives = 71/85 (83.53%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TrEMBL
Match: B9ZYL4_CUCSA (TFL1-like protein OS=Cucumis sativus GN=CsTFL1LC2 PE=2 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 9.2e-34 Identity = 70/89 (78.65%), Postives = 79/89 (88.76%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TrEMBL
Match: A4GG73_VITVI (TFL1C protein OS=Vitis vinifera GN=TFL1C PE=2 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.6e-30 Identity = 65/86 (75.58%), Postives = 76/86 (88.37%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TrEMBL
Match: A0A0J8BG86_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_3g066330 PE=4 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.1e-30 Identity = 59/86 (68.60%), Postives = 77/86 (89.53%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TrEMBL
Match: E3UKE9_BETVU (Brother of FT AND TFL1-like protein BFT1 OS=Beta vulgaris GN=BFT1 PE=2 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 2.1e-30 Identity = 59/86 (68.60%), Postives = 77/86 (89.53%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TrEMBL
Match: M1B4W5_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400014322 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 8.1e-30 Identity = 60/88 (68.18%), Postives = 76/88 (86.36%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TAIR10
Match: AT5G03840.1 (AT5G03840.1 PEBP (phosphatidylethanolamine-binding protein) family protein) HSP 1 Score: 128.6 bits (322), Expect = 1.9e-30 Identity = 62/87 (71.26%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TAIR10
Match: AT5G62040.1 (AT5G62040.1 PEBP (phosphatidylethanolamine-binding protein) family protein) HSP 1 Score: 128.6 bits (322), Expect = 1.9e-30 Identity = 57/86 (66.28%), Postives = 72/86 (83.72%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TAIR10
Match: AT2G27550.1 (AT2G27550.1 centroradialis) HSP 1 Score: 116.7 bits (291), Expect = 7.5e-27 Identity = 55/85 (64.71%), Postives = 65/85 (76.47%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TAIR10
Match: AT1G65480.1 (AT1G65480.1 PEBP (phosphatidylethanolamine-binding protein) family protein) HSP 1 Score: 104.0 bits (258), Expect = 5.0e-23 Identity = 46/89 (51.69%), Postives = 67/89 (75.28%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. TAIR10
Match: AT4G20370.1 (AT4G20370.1 PEBP (phosphatidylethanolamine-binding protein) family protein) HSP 1 Score: 100.9 bits (250), Expect = 4.2e-22 Identity = 46/85 (54.12%), Postives = 62/85 (72.94%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. NCBI nr
Match: gi|659077407|ref|XP_008439188.1| (PREDICTED: CEN-like protein 1 [Cucumis melo]) HSP 1 Score: 155.6 bits (392), Expect = 4.1e-35 Identity = 72/87 (82.76%), Postives = 80/87 (91.95%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. NCBI nr
Match: gi|525507244|ref|NP_001267660.1| (CEN-like protein 1-like [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 70/89 (78.65%), Postives = 79/89 (88.76%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. NCBI nr
Match: gi|1009122484|ref|XP_015878026.1| (PREDICTED: CEN-like protein 1 [Ziziphus jujuba]) HSP 1 Score: 141.7 bits (356), Expect = 6.2e-31 Identity = 63/90 (70.00%), Postives = 79/90 (87.78%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. NCBI nr
Match: gi|526118079|ref|NP_001267933.1| (TFL1C protein [Vitis vinifera]) HSP 1 Score: 139.8 bits (351), Expect = 2.3e-30 Identity = 65/86 (75.58%), Postives = 76/86 (88.37%), Query Frame = 1
BLAST of Cp4.1LG14g06110 vs. NCBI nr
Match: gi|743910328|ref|XP_011048673.1| (PREDICTED: CEN-like protein 1 [Populus euphratica]) HSP 1 Score: 139.4 bits (350), Expect = 3.1e-30 Identity = 62/90 (68.89%), Postives = 77/90 (85.56%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |