Cp4.1LG12g08050 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGCAACTCTGAGTCCCTCATCCTTTCTGCAAATTCCTCCATTGCAGAGGCTGAAGAACCTCTCAGTTTCCACTTCCTTCCTCCATGGCTCAGTTCCTCTGTCATTCCTCTCTAAGCCTTCGCCCTCGCTATCGGCCTCCCAAACCCCCAATTTCCTCCCCTCGATTAAGGCCATGAGGTCGCTGCAAGGCCGTGTGGTCTGCGCTACCAACGACAAGACCGTCGCCGTCGAGGTCGTGCGATTGGCGCCTCATCCGAAATACAAACGGCGCATTAGAATCAAGAAGAAGTACCAGGCGCACGATCCAGATAACAAATTCAAGGTCGGAGACTTTGTGGAGCTTGAAAAATGCCGGCCGATCAGCAAGATGAAGACGTTCCTGGCCATTCCGGTTCCGGCGAGGAATTCGAAGCCGAAAGCGGCGGAAGCCGGTGCTGGAGAGCTCGGGATTCCACTGGAGTCGCAGCAACAGGTTTAA ATGTCTGCAACTCTGAGTCCCTCATCCTTTCTGCAAATTCCTCCATTGCAGAGGCTGAAGAACCTCTCAGTTTCCACTTCCTTCCTCCATGGCTCAGTTCCTCTGTCATTCCTCTCTAAGCCTTCGCCCTCGCTATCGGCCTCCCAAACCCCCAATTTCCTCCCCTCGATTAAGGCCATGAGGTCGCTGCAAGGCCGTGTGGTCTGCGCTACCAACGACAAGACCGTCGCCGTCGAGGTCGTGCGATTGGCGCCTCATCCGAAATACAAACGGCGCATTAGAATCAAGAAGAAGTACCAGGCGCACGATCCAGATAACAAATTCAAGGTCGGAGACTTTGTGGAGCTTGAAAAATGCCGGCCGATCAGCAAGATGAAGACGTTCCTGGCCATTCCGGTTCCGGCGAGGAATTCGAAGCCGAAAGCGGCGGAAGCCGGTGCTGGAGAGCTCGGGATTCCACTGGAGTCGCAGCAACAGGTTTAA ATGTCTGCAACTCTGAGTCCCTCATCCTTTCTGCAAATTCCTCCATTGCAGAGGCTGAAGAACCTCTCAGTTTCCACTTCCTTCCTCCATGGCTCAGTTCCTCTGTCATTCCTCTCTAAGCCTTCGCCCTCGCTATCGGCCTCCCAAACCCCCAATTTCCTCCCCTCGATTAAGGCCATGAGGTCGCTGCAAGGCCGTGTGGTCTGCGCTACCAACGACAAGACCGTCGCCGTCGAGGTCGTGCGATTGGCGCCTCATCCGAAATACAAACGGCGCATTAGAATCAAGAAGAAGTACCAGGCGCACGATCCAGATAACAAATTCAAGGTCGGAGACTTTGTGGAGCTTGAAAAATGCCGGCCGATCAGCAAGATGAAGACGTTCCTGGCCATTCCGGTTCCGGCGAGGAATTCGAAGCCGAAAGCGGCGGAAGCCGGTGCTGGAGAGCTCGGGATTCCACTGGAGTCGCAGCAACAGGTTTAA MSATLSPSSFLQIPPLQRLKNLSVSTSFLHGSVPLSFLSKPSPSLSASQTPNFLPSIKAMRSLQGRVVCATNDKTVAVEVVRLAPHPKYKRRIRIKKKYQAHDPDNKFKVGDFVELEKCRPISKMKTFLAIPVPARNSKPKAAEAGAGELGIPLESQQQV
BLAST of Cp4.1LG12g08050 vs. Swiss-Prot
Match: RR17_ARATH (30S ribosomal protein S17, chloroplastic OS=Arabidopsis thaliana GN=RPS17 PE=1 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 3.6e-42 Identity = 94/141 (66.67%), Postives = 114/141 (80.85%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. Swiss-Prot
Match: RR17_PEA (30S ribosomal protein S17, chloroplastic (Fragment) OS=Pisum sativum GN=RPS17 PE=2 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 2.8e-34 Identity = 77/134 (57.46%), Postives = 98/134 (73.13%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. Swiss-Prot
Match: RR17_MAIZE (30S ribosomal protein S17, chloroplastic OS=Zea mays GN=RPS17 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.1e-27 Identity = 70/111 (63.06%), Postives = 80/111 (72.07%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. Swiss-Prot
Match: RR17_ORYSJ (30S ribosomal protein S17, chloroplastic OS=Oryza sativa subsp. japonica GN=RPS17 PE=2 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.5e-27 Identity = 66/103 (64.08%), Postives = 78/103 (75.73%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. Swiss-Prot
Match: RS17_RHOSK (30S ribosomal protein S17 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsQ PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.5e-13 Identity = 36/71 (50.70%), Postives = 48/71 (67.61%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TrEMBL
Match: A0A0A0K952_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G446990 PE=3 SV=1) HSP 1 Score: 258.8 bits (660), Expect = 4.2e-66 Identity = 138/162 (85.19%), Postives = 146/162 (90.12%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TrEMBL
Match: W9RUW3_9ROSA (30S ribosomal protein S17 OS=Morus notabilis GN=L484_026214 PE=3 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 6.6e-51 Identity = 110/160 (68.75%), Postives = 129/160 (80.62%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TrEMBL
Match: D7U0I2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_09s0002g04330 PE=3 SV=1) HSP 1 Score: 192.6 bits (488), Expect = 3.7e-46 Identity = 104/147 (70.75%), Postives = 120/147 (81.63%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TrEMBL
Match: A0A061GAC0_THECC (Ribosomal protein S17 OS=Theobroma cacao GN=TCM_028766 PE=3 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 8.3e-46 Identity = 98/142 (69.01%), Postives = 120/142 (84.51%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TrEMBL
Match: A0A068TRN2_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00021991001 PE=3 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 1.8e-45 Identity = 109/161 (67.70%), Postives = 127/161 (78.88%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TAIR10
Match: AT1G79850.1 (AT1G79850.1 ribosomal protein S17) HSP 1 Score: 172.6 bits (436), Expect = 2.0e-43 Identity = 94/141 (66.67%), Postives = 114/141 (80.85%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. TAIR10
Match: AT1G49400.1 (AT1G49400.1 Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 48.9 bits (115), Expect = 3.4e-06 Identity = 32/88 (36.36%), Postives = 47/88 (53.41%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. NCBI nr
Match: gi|659124452|ref|XP_008462167.1| (PREDICTED: 30S ribosomal protein S17, chloroplastic [Cucumis melo]) HSP 1 Score: 263.5 bits (672), Expect = 2.5e-67 Identity = 141/162 (87.04%), Postives = 147/162 (90.74%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. NCBI nr
Match: gi|449448022|ref|XP_004141765.1| (PREDICTED: 30S ribosomal protein S17, chloroplastic [Cucumis sativus]) HSP 1 Score: 258.8 bits (660), Expect = 6.1e-66 Identity = 138/162 (85.19%), Postives = 146/162 (90.12%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. NCBI nr
Match: gi|703104735|ref|XP_010098081.1| (30S ribosomal protein S17 [Morus notabilis]) HSP 1 Score: 208.4 bits (529), Expect = 9.4e-51 Identity = 110/160 (68.75%), Postives = 129/160 (80.62%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. NCBI nr
Match: gi|1009112335|ref|XP_015867702.1| (PREDICTED: 30S ribosomal protein S17, chloroplastic [Ziziphus jujuba]) HSP 1 Score: 201.4 bits (511), Expect = 1.2e-48 Identity = 110/159 (69.18%), Postives = 128/159 (80.50%), Query Frame = 1
BLAST of Cp4.1LG12g08050 vs. NCBI nr
Match: gi|719994125|ref|XP_010254084.1| (PREDICTED: 30S ribosomal protein S17, chloroplastic [Nelumbo nucifera]) HSP 1 Score: 200.3 bits (508), Expect = 2.6e-48 Identity = 107/155 (69.03%), Postives = 129/155 (83.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|