Cp4.1LG03g04480 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGATGAAGAAGATCGCCTGCGCCGTCCTCTTCGCTGCCGCAACCGTCAGCGCCGTCGTGGCTCACGACGAGGCGTTGGCTCCAGCACCTGGACCAAGCAGCGGTGCCGCTGCCGGCCTTCCAGCAATCGGCTCTGTCATTGGCGCTTCGTTGCTCTCTGTCGCGGCCTACTACCTGCAATGA ATGGAGATGAAGAAGATCGCCTGCGCCGTCCTCTTCGCTGCCGCAACCGTCAGCGCCGTCGTGGCTCACGACGAGGCGTTGGCTCCAGCACCTGGACCAAGCAGCGGTGCCGCTGCCGGCCTTCCAGCAATCGGCTCTGTCATTGGCGCTTCGTTGCTCTCTGTCGCGGCCTACTACCTGCAATGA ATGGAGATGAAGAAGATCGCCTGCGCCGTCCTCTTCGCTGCCGCAACCGTCAGCGCCGTCGTGGCTCACGACGAGGCGTTGGCTCCAGCACCTGGACCAAGCAGCGGTGCCGCTGCCGGCCTTCCAGCAATCGGCTCTGTCATTGGCGCTTCGTTGCTCTCTGTCGCGGCCTACTACCTGCAATGA MEMKKIACAVLFAAATVSAVVAHDEALAPAPGPSSGAAAGLPAIGSVIGASLLSVAAYYLQ
BLAST of Cp4.1LG03g04480 vs. Swiss-Prot
Match: AGP23_ARATH (Arabinogalactan peptide 23 OS=Arabidopsis thaliana GN=AGP23 PE=2 SV=2) HSP 1 Score: 72.8 bits (177), Expect = 1.5e-12 Identity = 40/60 (66.67%), Postives = 53/60 (88.33%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TrEMBL
Match: A0A0A0L9U8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G697910 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.5e-16 Identity = 52/60 (86.67%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TrEMBL
Match: W9SPR6_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_000818 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.5e-11 Identity = 41/60 (68.33%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TrEMBL
Match: A0A059DIY4_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_A02403 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.3e-11 Identity = 41/61 (67.21%), Postives = 53/61 (86.89%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TrEMBL
Match: A0A0D3DU11_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 9.6e-11 Identity = 41/60 (68.33%), Postives = 54/60 (90.00%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TrEMBL
Match: A0A078CAG3_BRANA (BnaC08g28710D protein OS=Brassica napus GN=BnaC08g28710D PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 9.6e-11 Identity = 41/60 (68.33%), Postives = 54/60 (90.00%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TAIR10
Match: AT3G57690.1 (AT3G57690.1 arabinogalactan protein 23) HSP 1 Score: 72.8 bits (177), Expect = 8.3e-14 Identity = 40/60 (66.67%), Postives = 53/60 (88.33%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. TAIR10
Match: AT2G41905.1 (AT2G41905.1 BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1)) HSP 1 Score: 62.4 bits (150), Expect = 1.1e-10 Identity = 39/61 (63.93%), Postives = 52/61 (85.25%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. NCBI nr
Match: gi|700203465|gb|KGN58598.1| (hypothetical protein Csa_3G697910 [Cucumis sativus]) HSP 1 Score: 91.3 bits (225), Expect = 6.4e-16 Identity = 52/60 (86.67%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. NCBI nr
Match: gi|703130749|ref|XP_010104709.1| (hypothetical protein L484_000818 [Morus notabilis]) HSP 1 Score: 75.5 bits (184), Expect = 3.6e-11 Identity = 41/60 (68.33%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. NCBI nr
Match: gi|629125825|gb|KCW90250.1| (hypothetical protein EUGRSUZ_A02403, partial [Eucalyptus grandis]) HSP 1 Score: 74.7 bits (182), Expect = 6.2e-11 Identity = 41/61 (67.21%), Postives = 53/61 (86.89%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. NCBI nr
Match: gi|674961597|emb|CDX72003.1| (BnaC08g28710D [Brassica napus]) HSP 1 Score: 73.6 bits (179), Expect = 1.4e-10 Identity = 41/60 (68.33%), Postives = 54/60 (90.00%), Query Frame = 1
BLAST of Cp4.1LG03g04480 vs. NCBI nr
Match: gi|224106059|ref|XP_002314029.1| (hypothetical protein POPTR_0009s06810g [Populus trichocarpa]) HSP 1 Score: 72.8 bits (177), Expect = 2.4e-10 Identity = 43/61 (70.49%), Postives = 51/61 (83.61%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |