Carg07320 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGATGAAGAAGATCAACTGCGCCATTCTCTTCGCTGCCGCAACGGTCAGCGCCGTCGTTGCTCATGATGAGGCAGCGGCTCCAGCACCTGGACCAACCAGCGGCGCCACCGCCGGCCTTCCGGCAATCAGCTCTCTCATCGGCGCTTCGTTGCTCTCCGTCGCGGCCTACTACTTCCAGTGA ATGGAGATGAAGAAGATCAACTGCGCCATTCTCTTCGCTGCCGCAACGGTCAGCGCCGTCGTTGCTCATGATGAGGCAGCGGCTCCAGCACCTGGACCAACCAGCGGCGCCACCGCCGGCCTTCCGGCAATCAGCTCTCTCATCGGCGCTTCGTTGCTCTCCGTCGCGGCCTACTACTTCCAGTGA ATGGAGATGAAGAAGATCAACTGCGCCATTCTCTTCGCTGCCGCAACGGTCAGCGCCGTCGTTGCTCATGATGAGGCAGCGGCTCCAGCACCTGGACCAACCAGCGGCGCCACCGCCGGCCTTCCGGCAATCAGCTCTCTCATCGGCGCTTCGTTGCTCTCCGTCGCGGCCTACTACTTCCAGTGA MEMKKINCAILFAAATVSAVVAHDEAAAPAPGPTSGATAGLPAISSLIGASLLSVAAYYFQ
BLAST of Carg07320 vs. NCBI nr
Match: XP_022998512.1 (arabinogalactan peptide 23-like [Cucurbita maxima]) HSP 1 Score: 87.4 bits (215), Expect = 1.8e-14 Identity = 49/61 (80.33%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of Carg07320 vs. NCBI nr
Match: XP_022932375.1 (arabinogalactan peptide 23-like [Cucurbita moschata] >XP_022965239.1 arabinogalactan peptide 23-like [Cucurbita maxima]) HSP 1 Score: 80.1 bits (196), Expect = 2.9e-12 Identity = 44/61 (72.13%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of Carg07320 vs. NCBI nr
Match: XP_010104709.1 (arabinogalactan peptide 23 [Morus notabilis] >EXC48805.1 hypothetical protein L484_000818 [Morus notabilis]) HSP 1 Score: 68.2 bits (165), Expect = 1.1e-08 Identity = 36/59 (61.02%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Carg07320 vs. NCBI nr
Match: XP_022933008.1 (arabinogalactan peptide 23-like [Cucurbita moschata]) HSP 1 Score: 64.7 bits (156), Expect = 1.2e-07 Identity = 38/62 (61.29%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Carg07320 vs. NCBI nr
Match: XP_023004714.1 (arabinogalactan peptide 23-like [Cucurbita maxima]) HSP 1 Score: 64.7 bits (156), Expect = 1.2e-07 Identity = 38/62 (61.29%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Carg07320 vs. TAIR10
Match: AT3G57690.1 (arabinogalactan protein 23) HSP 1 Score: 62.0 bits (149), Expect = 1.5e-10 Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of Carg07320 vs. TAIR10
Match: AT2G41905.1 (BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1)) HSP 1 Score: 50.4 bits (119), Expect = 4.4e-07 Identity = 37/60 (61.67%), Postives = 48/60 (80.00%), Query Frame = 0
BLAST of Carg07320 vs. Swiss-Prot
Match: sp|Q8S2W4|AGP23_ARATH (Arabinogalactan protein 23 OS=Arabidopsis thaliana OX=3702 GN=AGP23 PE=1 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 2.6e-09 Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of Carg07320 vs. TrEMBL
Match: tr|W9SPR6|W9SPR6_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_000818 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.5e-09 Identity = 36/59 (61.02%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Carg07320 vs. TrEMBL
Match: tr|A0A2K2C4B1|A0A2K2C4B1_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_001G268800v3 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.8e-07 Identity = 38/61 (62.30%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of Carg07320 vs. TrEMBL
Match: tr|M4DDP3|M4DDP3_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis OX=51351 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-07 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Carg07320 vs. TrEMBL
Match: tr|A0A0D3CUE4|A0A0D3CUE4_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea OX=109376 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-07 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 0
BLAST of Carg07320 vs. TrEMBL
Match: tr|A0A0D3BX83|A0A0D3BX83_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea OX=109376 GN=106341113 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-07 Identity = 33/59 (55.93%), Postives = 44/59 (74.58%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |