Cp4.1LG02g05990 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAGGCCTACGACGCTGCTCCAACGACCTCCTCCTCCTCGACCTATCTCCGCCTTCCTCCGTCCCCTCCACCGCCTCCCTTTCCATCGACGTTGCCGAGTCCGCCGAGACACGAATCCGTCGCCTCATCTCCGAACATCCAGTCATCATCTTTAGCCGCACTTCTTGTTGCATGTGCCACGTCATGAAGAAGCTTCTCGCCTCCATCGGCGTTCACCCTACCGTCATCGAATTAGACGACCACGAGATCGACGCTCTCGCCTCCTTCTCCTCCACCACACCCGCAGCCACTCCTGCCGTTTTCATCGGTGGCTCCTATGTCGGCGGCCTTGAATCCCTCGTCGCACTCCACCTCAGCGGCCACCTCGTACCTAAGCTTGTCGAAGTCGGCGCTCTCTGGGTATGA ATGCAAGGCCTACGACGCTGCTCCAACGACCTCCTCCTCCTCGACCTATCTCCGCCTTCCTCCGTCCCCTCCACCGCCTCCCTTTCCATCGACGTTGCCGAGTCCGCCGAGACACGAATCCGTCGCCTCATCTCCGAACATCCAGTCATCATCTTTAGCCGCACTTCTTGTTGCATGTGCCACGTCATGAAGAAGCTTCTCGCCTCCATCGGCGTTCACCCTACCGTCATCGAATTAGACGACCACGAGATCGACGCTCTCGCCTCCTTCTCCTCCACCACACCCGCAGCCACTCCTGCCGTTTTCATCGGTGGCTCCTATGTCGGCGGCCTTGAATCCCTCGTCGCACTCCACCTCAGCGGCCACCTCGTACCTAAGCTTGTCGAAGTCGGCGCTCTCTGGGTATGA ATGCAAGGCCTACGACGCTGCTCCAACGACCTCCTCCTCCTCGACCTATCTCCGCCTTCCTCCGTCCCCTCCACCGCCTCCCTTTCCATCGACGTTGCCGAGTCCGCCGAGACACGAATCCGTCGCCTCATCTCCGAACATCCAGTCATCATCTTTAGCCGCACTTCTTGTTGCATGTGCCACGTCATGAAGAAGCTTCTCGCCTCCATCGGCGTTCACCCTACCGTCATCGAATTAGACGACCACGAGATCGACGCTCTCGCCTCCTTCTCCTCCACCACACCCGCAGCCACTCCTGCCGTTTTCATCGGTGGCTCCTATGTCGGCGGCCTTGAATCCCTCGTCGCACTCCACCTCAGCGGCCACCTCGTACCTAAGCTTGTCGAAGTCGGCGCTCTCTGGGTATGA MQGLRRCSNDLLLLDLSPPSSVPSTASLSIDVAESAETRIRRLISEHPVIIFSRTSCCMCHVMKKLLASIGVHPTVIELDDHEIDALASFSSTTPAATPAVFIGGSYVGGLESLVALHLSGHLVPKLVEVGALWV
BLAST of Cp4.1LG02g05990 vs. Swiss-Prot
Match: GRXC6_ARATH (Glutaredoxin-C6 OS=Arabidopsis thaliana GN=GRXC6 PE=2 SV=2) HSP 1 Score: 173.3 bits (438), Expect = 1.8e-42 Identity = 96/140 (68.57%), Postives = 108/140 (77.14%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. Swiss-Prot
Match: GRC10_ARATH (Glutaredoxin-C10 OS=Arabidopsis thaliana GN=GRXC10 PE=2 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.3e-37 Identity = 89/150 (59.33%), Postives = 107/150 (71.33%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. Swiss-Prot
Match: GRXC7_ORYSJ (Glutaredoxin-C7 OS=Oryza sativa subsp. japonica GN=GRXC7 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.5e-25 Identity = 58/100 (58.00%), Postives = 74/100 (74.00%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. Swiss-Prot
Match: GRXC5_ORYSJ (Glutaredoxin-C5 OS=Oryza sativa subsp. japonica GN=GRXC5 PE=2 SV=2) HSP 1 Score: 101.7 bits (252), Expect = 6.6e-21 Identity = 52/122 (42.62%), Postives = 72/122 (59.02%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. Swiss-Prot
Match: GRXS2_ORYSJ (Monothiol glutaredoxin-S2 OS=Oryza sativa subsp. japonica GN=GRXS2 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.5e-20 Identity = 59/114 (51.75%), Postives = 76/114 (66.67%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TrEMBL
Match: A0A0A0L5B1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G646150 PE=4 SV=1) HSP 1 Score: 227.6 bits (579), Expect = 8.8e-57 Identity = 121/136 (88.97%), Postives = 128/136 (94.12%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TrEMBL
Match: I1SSK1_HEVBR (Glutaredoxin 2.1 OS=Hevea brasiliensis GN=Grx2.1 PE=2 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 4.9e-47 Identity = 107/147 (72.79%), Postives = 117/147 (79.59%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TrEMBL
Match: I1SSK0_HEVBR (Glutaredoxin 2 OS=Hevea brasiliensis GN=Grx2 PE=2 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 8.3e-47 Identity = 107/148 (72.30%), Postives = 117/148 (79.05%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TrEMBL
Match: A0A067KP67_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_07656 PE=4 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 7.0e-46 Identity = 107/156 (68.59%), Postives = 120/156 (76.92%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TrEMBL
Match: A0A0L9V1W0_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan07g256100 PE=4 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 2.7e-45 Identity = 102/142 (71.83%), Postives = 116/142 (81.69%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TAIR10
Match: AT4G33040.1 (AT4G33040.1 Thioredoxin superfamily protein) HSP 1 Score: 173.3 bits (438), Expect = 1.0e-43 Identity = 96/140 (68.57%), Postives = 108/140 (77.14%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TAIR10
Match: AT5G11930.1 (AT5G11930.1 Thioredoxin superfamily protein) HSP 1 Score: 157.1 bits (396), Expect = 7.4e-39 Identity = 89/150 (59.33%), Postives = 107/150 (71.33%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TAIR10
Match: AT1G28480.1 (AT1G28480.1 Thioredoxin superfamily protein) HSP 1 Score: 92.0 bits (227), Expect = 2.9e-19 Identity = 52/142 (36.62%), Postives = 80/142 (56.34%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TAIR10
Match: AT3G02000.1 (AT3G02000.1 Thioredoxin superfamily protein) HSP 1 Score: 90.9 bits (224), Expect = 6.5e-19 Identity = 49/113 (43.36%), Postives = 67/113 (59.29%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 88.6 bits (218), Expect = 3.2e-18 Identity = 45/100 (45.00%), Postives = 62/100 (62.00%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. NCBI nr
Match: gi|449447128|ref|XP_004141321.1| (PREDICTED: glutaredoxin-C6 [Cucumis sativus]) HSP 1 Score: 227.6 bits (579), Expect = 1.3e-56 Identity = 121/136 (88.97%), Postives = 128/136 (94.12%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. NCBI nr
Match: gi|1009134593|ref|XP_015884532.1| (PREDICTED: glutaredoxin-C6-like [Ziziphus jujuba]) HSP 1 Score: 203.4 bits (516), Expect = 2.6e-49 Identity = 112/142 (78.87%), Postives = 121/142 (85.21%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. NCBI nr
Match: gi|470109536|ref|XP_004291050.1| (PREDICTED: glutaredoxin-C6 [Fragaria vesca subsp. vesca]) HSP 1 Score: 195.7 bits (496), Expect = 5.3e-47 Identity = 106/139 (76.26%), Postives = 116/139 (83.45%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. NCBI nr
Match: gi|329750629|gb|AEC03330.1| (glutaredoxin 2.1 [Hevea brasiliensis]) HSP 1 Score: 195.3 bits (495), Expect = 7.0e-47 Identity = 107/147 (72.79%), Postives = 117/147 (79.59%), Query Frame = 1
BLAST of Cp4.1LG02g05990 vs. NCBI nr
Match: gi|329750627|gb|AEC03329.1| (glutaredoxin 2 [Hevea brasiliensis]) HSP 1 Score: 194.5 bits (493), Expect = 1.2e-46 Identity = 107/148 (72.30%), Postives = 117/148 (79.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|