CmaCh08G000090 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGCATTACCAGGCAGGGCGTTCATGGGAATACTACATGCCGCCCACTGCAGCCAGAGACCCAGTGGACCGTGTACTCCGGCTTGCGGCGGAGAGCGCGGTGGTGATATTCAGCGTCAGCAGCTGCTGCATGTGCCACGCTCTCAAGCGCCTGCTATGCGGTATGGGAGTGAGCCCAACCGTGTACGAGCTGGACCACGACCCCAGAGGAAAAGAAATTGAAAGGGCTTTAATGAGGCTCGTCGGACCCGCCGCACCGTCGGTGCCGGTCGTCTTTATTGGCGGAAAGCTGGTGGGCTCTATGGACAGAGTTATGGCTTCTCACATCAATGGAACTTTGGTCCCTCTTCTCAAGGAAGCCGGGGCCTTATGGCTTTAG ATGATGCATTACCAGGCAGGGCGTTCATGGGAATACTACATGCCGCCCACTGCAGCCAGAGACCCAGTGGACCGTGTACTCCGGCTTGCGGCGGAGAGCGCGGTGGTGATATTCAGCGTCAGCAGCTGCTGCATGTGCCACGCTCTCAAGCGCCTGCTATGCGGTATGGGAGTGAGCCCAACCGTGTACGAGCTGGACCACGACCCCAGAGGAAAAGAAATTGAAAGGGCTTTAATGAGGCTCGTCGGACCCGCCGCACCGTCGGTGCCGGTCGTCTTTATTGGCGGAAAGCTGGTGGGCTCTATGGACAGAGTTATGGCTTCTCACATCAATGGAACTTTGGTCCCTCTTCTCAAGGAAGCCGGGGCCTTATGGCTTTAG ATGATGCATTACCAGGCAGGGCGTTCATGGGAATACTACATGCCGCCCACTGCAGCCAGAGACCCAGTGGACCGTGTACTCCGGCTTGCGGCGGAGAGCGCGGTGGTGATATTCAGCGTCAGCAGCTGCTGCATGTGCCACGCTCTCAAGCGCCTGCTATGCGGTATGGGAGTGAGCCCAACCGTGTACGAGCTGGACCACGACCCCAGAGGAAAAGAAATTGAAAGGGCTTTAATGAGGCTCGTCGGACCCGCCGCACCGTCGGTGCCGGTCGTCTTTATTGGCGGAAAGCTGGTGGGCTCTATGGACAGAGTTATGGCTTCTCACATCAATGGAACTTTGGTCCCTCTTCTCAAGGAAGCCGGGGCCTTATGGCTTTAG MMHYQAGRSWEYYMPPTAARDPVDRVLRLAAESAVVIFSVSSCCMCHALKRLLCGMGVSPTVYELDHDPRGKEIERALMRLVGPAAPSVPVVFIGGKLVGSMDRVMASHINGTLVPLLKEAGALWL
BLAST of CmaCh08G000090 vs. Swiss-Prot
Match: GRXC3_ORYSJ (Glutaredoxin-C3 OS=Oryza sativa subsp. japonica GN=GRXC3 PE=2 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 8.8e-44 Identity = 95/135 (70.37%), Postives = 106/135 (78.52%), Query Frame = 1
BLAST of CmaCh08G000090 vs. Swiss-Prot
Match: GRXC5_ORYSJ (Glutaredoxin-C5 OS=Oryza sativa subsp. japonica GN=GRXC5 PE=2 SV=2) HSP 1 Score: 172.6 bits (436), Expect = 2.8e-42 Identity = 90/135 (66.67%), Postives = 104/135 (77.04%), Query Frame = 1
BLAST of CmaCh08G000090 vs. Swiss-Prot
Match: GRXC1_ORYSJ (Glutaredoxin-C1 OS=Oryza sativa subsp. japonica GN=GRXC1 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 9.7e-35 Identity = 70/104 (67.31%), Postives = 88/104 (84.62%), Query Frame = 1
BLAST of CmaCh08G000090 vs. Swiss-Prot
Match: GRXC7_ARATH (Glutaredoxin-C7 OS=Arabidopsis thaliana GN=GRXC7 PE=1 SV=2) HSP 1 Score: 146.4 bits (368), Expect = 2.2e-34 Identity = 75/106 (70.75%), Postives = 89/106 (83.96%), Query Frame = 1
BLAST of CmaCh08G000090 vs. Swiss-Prot
Match: GRXC8_ARATH (Glutaredoxin-C8 OS=Arabidopsis thaliana GN=GRXC8 PE=1 SV=2) HSP 1 Score: 142.9 bits (359), Expect = 2.4e-33 Identity = 72/108 (66.67%), Postives = 89/108 (82.41%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TrEMBL
Match: U3RGD6_CUCSA (Glutaredoxin OS=Cucumis sativus GN=GRX7 PE=2 SV=1) HSP 1 Score: 237.3 bits (604), Expect = 1.0e-59 Identity = 117/128 (91.41%), Postives = 121/128 (94.53%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TrEMBL
Match: W9QWA6_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_017485 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 2.4e-48 Identity = 102/130 (78.46%), Postives = 112/130 (86.15%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TrEMBL
Match: M5XSA7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa021177mg PE=4 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 5.3e-48 Identity = 100/127 (78.74%), Postives = 113/127 (88.98%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TrEMBL
Match: A0A0A0LMK1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G405010 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 2.0e-47 Identity = 94/125 (75.20%), Postives = 110/125 (88.00%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TrEMBL
Match: B9RM97_RICCO (Glutaredoxin, grx, putative OS=Ricinus communis GN=RCOM_1078780 PE=4 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 3.5e-47 Identity = 99/129 (76.74%), Postives = 110/129 (85.27%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TAIR10
Match: AT3G02000.1 (AT3G02000.1 Thioredoxin superfamily protein) HSP 1 Score: 146.4 bits (368), Expect = 1.2e-35 Identity = 75/106 (70.75%), Postives = 89/106 (83.96%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TAIR10
Match: AT5G14070.1 (AT5G14070.1 Thioredoxin superfamily protein) HSP 1 Score: 142.9 bits (359), Expect = 1.3e-34 Identity = 72/108 (66.67%), Postives = 89/108 (82.41%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TAIR10
Match: AT5G18600.1 (AT5G18600.1 Thioredoxin superfamily protein) HSP 1 Score: 122.1 bits (305), Expect = 2.5e-28 Identity = 57/104 (54.81%), Postives = 77/104 (74.04%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 119.4 bits (298), Expect = 1.6e-27 Identity = 57/104 (54.81%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of CmaCh08G000090 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 119.4 bits (298), Expect = 1.6e-27 Identity = 57/104 (54.81%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of CmaCh08G000090 vs. NCBI nr
Match: gi|821595495|ref|NP_001295802.1| (glutaredoxin-C1-like [Cucumis sativus]) HSP 1 Score: 237.3 bits (604), Expect = 1.5e-59 Identity = 117/128 (91.41%), Postives = 121/128 (94.53%), Query Frame = 1
BLAST of CmaCh08G000090 vs. NCBI nr
Match: gi|659119876|ref|XP_008459889.1| (PREDICTED: glutaredoxin-C1-like [Cucumis melo]) HSP 1 Score: 236.1 bits (601), Expect = 3.3e-59 Identity = 116/128 (90.62%), Postives = 121/128 (94.53%), Query Frame = 1
BLAST of CmaCh08G000090 vs. NCBI nr
Match: gi|1009129414|ref|XP_015881752.1| (PREDICTED: glutaredoxin-C1-like [Ziziphus jujuba]) HSP 1 Score: 201.1 bits (510), Expect = 1.2e-48 Identity = 100/128 (78.12%), Postives = 113/128 (88.28%), Query Frame = 1
BLAST of CmaCh08G000090 vs. NCBI nr
Match: gi|645231058|ref|XP_008222218.1| (PREDICTED: glutaredoxin-C1-like [Prunus mume]) HSP 1 Score: 200.3 bits (508), Expect = 2.0e-48 Identity = 101/128 (78.91%), Postives = 114/128 (89.06%), Query Frame = 1
BLAST of CmaCh08G000090 vs. NCBI nr
Match: gi|703077781|ref|XP_010090679.1| (hypothetical protein L484_017485 [Morus notabilis]) HSP 1 Score: 199.5 bits (506), Expect = 3.4e-48 Identity = 102/130 (78.46%), Postives = 112/130 (86.15%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|