CmaCh02G010530 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAGGGTGAAGAGATTAGCAGCTGAGCATGAGGTGCTGATAATAAGTAAGACTTCATGCTGCCTTTGTTATGCAGTCAATGTTCTTCTAAGGGAGCTTGGAGTTAGCCCCTTGGTGTACGAGCTGGACCAGGACCCTGATGCCCGGGACATGGAGAAGGCTCTTGTAAGGCTACAAGGCTGCCATACGCCCGCCGTCCCCGCCGTCTTCATCGCCGGGGACCTCGTCGGCTCAACCAACGAAGTCATGTCGCTGCACCTCAGCGGAGAGCTCAATCGAATGCTGAAGCCCTTCAAGGTGGTTCAAGAGAACTAG ATGGAAAGGGTGAAGAGATTAGCAGCTGAGCATGAGGTGCTGATAATAAGTAAGACTTCATGCTGCCTTTGTTATGCAGTCAATGTTCTTCTAAGGGAGCTTGGAGTTAGCCCCTTGGTGTACGAGCTGGACCAGGACCCTGATGCCCGGGACATGGAGAAGGCTCTTGTAAGGCTACAAGGCTGCCATACGCCCGCCGTCCCCGCCGTCTTCATCGCCGGGGACCTCGTCGGCTCAACCAACGAAGTCATGTCGCTGCACCTCAGCGGAGAGCTCAATCGAATGCTGAAGCCCTTCAAGGTGGTTCAAGAGAACTAG ATGGAAAGGGTGAAGAGATTAGCAGCTGAGCATGAGGTGCTGATAATAAGTAAGACTTCATGCTGCCTTTGTTATGCAGTCAATGTTCTTCTAAGGGAGCTTGGAGTTAGCCCCTTGGTGTACGAGCTGGACCAGGACCCTGATGCCCGGGACATGGAGAAGGCTCTTGTAAGGCTACAAGGCTGCCATACGCCCGCCGTCCCCGCCGTCTTCATCGCCGGGGACCTCGTCGGCTCAACCAACGAAGTCATGTCGCTGCACCTCAGCGGAGAGCTCAATCGAATGCTGAAGCCCTTCAAGGTGGTTCAAGAGAACTAG MERVKRLAAEHEVLIISKTSCCLCYAVNVLLRELGVSPLVYELDQDPDARDMEKALVRLQGCHTPAVPAVFIAGDLVGSTNEVMSLHLSGELNRMLKPFKVVQEN
BLAST of CmaCh02G010530 vs. Swiss-Prot
Match: GRC13_ARATH (Glutaredoxin-C13 OS=Arabidopsis thaliana GN=GRXC13 PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.3e-28 Identity = 60/102 (58.82%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of CmaCh02G010530 vs. Swiss-Prot
Match: GRXS9_ARATH (Monothiol glutaredoxin-S9 OS=Arabidopsis thaliana GN=GRXS9 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.1e-27 Identity = 59/100 (59.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. Swiss-Prot
Match: GRC14_ARATH (Glutaredoxin-C14 OS=Arabidopsis thaliana GN=GRXC14 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.1e-27 Identity = 59/100 (59.00%), Postives = 81/100 (81.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. Swiss-Prot
Match: GRS11_ARATH (Monothiol glutaredoxin-S11 OS=Arabidopsis thaliana GN=GRXS11 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.2e-25 Identity = 57/99 (57.58%), Postives = 80/99 (80.81%), Query Frame = 1
BLAST of CmaCh02G010530 vs. Swiss-Prot
Match: GRXC1_ORYSJ (Glutaredoxin-C1 OS=Oryza sativa subsp. japonica GN=GRXC1 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 7.6e-25 Identity = 59/97 (60.82%), Postives = 74/97 (76.29%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TrEMBL
Match: A0A0A0K5I6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G230940 PE=4 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 1.3e-44 Identity = 90/105 (85.71%), Postives = 101/105 (96.19%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TrEMBL
Match: A0A0L9TX27_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g109200 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.2e-30 Identity = 67/100 (67.00%), Postives = 86/100 (86.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TrEMBL
Match: A0A0S3SS66_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G243600 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 3.2e-30 Identity = 67/100 (67.00%), Postives = 86/100 (86.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TrEMBL
Match: A0A166DAH0_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_005845 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 4.2e-30 Identity = 66/105 (62.86%), Postives = 85/105 (80.95%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TrEMBL
Match: A0A166HE67_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_002796 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 5.5e-30 Identity = 65/102 (63.73%), Postives = 87/102 (85.29%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TAIR10
Match: AT2G47880.1 (AT2G47880.1 Glutaredoxin family protein) HSP 1 Score: 125.2 bits (313), Expect = 2.4e-29 Identity = 60/102 (58.82%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TAIR10
Match: AT2G30540.1 (AT2G30540.1 Thioredoxin superfamily protein) HSP 1 Score: 122.9 bits (307), Expect = 1.2e-28 Identity = 59/100 (59.00%), Postives = 82/100 (82.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TAIR10
Match: AT3G62960.1 (AT3G62960.1 Thioredoxin superfamily protein) HSP 1 Score: 122.9 bits (307), Expect = 1.2e-28 Identity = 59/100 (59.00%), Postives = 81/100 (81.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TAIR10
Match: AT1G06830.1 (AT1G06830.1 Glutaredoxin family protein) HSP 1 Score: 117.1 bits (292), Expect = 6.6e-27 Identity = 57/99 (57.58%), Postives = 80/99 (80.81%), Query Frame = 1
BLAST of CmaCh02G010530 vs. TAIR10
Match: AT2G47870.1 (AT2G47870.1 Thioredoxin superfamily protein) HSP 1 Score: 106.3 bits (264), Expect = 1.2e-23 Identity = 50/97 (51.55%), Postives = 70/97 (72.16%), Query Frame = 1
BLAST of CmaCh02G010530 vs. NCBI nr
Match: gi|449444230|ref|XP_004139878.1| (PREDICTED: glutaredoxin-C13-like [Cucumis sativus]) HSP 1 Score: 186.8 bits (473), Expect = 1.9e-44 Identity = 90/105 (85.71%), Postives = 101/105 (96.19%), Query Frame = 1
BLAST of CmaCh02G010530 vs. NCBI nr
Match: gi|1012183911|ref|XP_015968943.1| (PREDICTED: monothiol glutaredoxin-S11-like [Arachis duranensis]) HSP 1 Score: 139.4 bits (350), Expect = 3.5e-30 Identity = 66/100 (66.00%), Postives = 87/100 (87.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. NCBI nr
Match: gi|920691717|gb|KOM34942.1| (hypothetical protein LR48_Vigan02g109200 [Vigna angularis]) HSP 1 Score: 139.0 bits (349), Expect = 4.6e-30 Identity = 67/100 (67.00%), Postives = 86/100 (86.00%), Query Frame = 1
BLAST of CmaCh02G010530 vs. NCBI nr
Match: gi|1021047228|gb|KZN05008.1| (hypothetical protein DCAR_005845 [Daucus carota subsp. sativus]) HSP 1 Score: 138.7 bits (348), Expect = 6.0e-30 Identity = 66/105 (62.86%), Postives = 85/105 (80.95%), Query Frame = 1
BLAST of CmaCh02G010530 vs. NCBI nr
Match: gi|1021047229|gb|KZN05009.1| (hypothetical protein DCAR_005846 [Daucus carota subsp. sativus]) HSP 1 Score: 138.3 bits (347), Expect = 7.9e-30 Identity = 66/105 (62.86%), Postives = 84/105 (80.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |