Cla97C08G151460 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTTATACCCTACAGGATCCAGCCTCCCAGACTGTTCCCATGCATGTGGACCATGTTTTCCGTGCAAAAGGGTGATGGTGAGCTTCAAATGCTCTGTTGCAGAGTCTTGTCCAACTGTCTACAGATGCATGTGTAAAGGGAAATATTATCATGTACCCTCCAATTGA ATGGAGTTATACCCTACAGGATCCAGCCTCCCAGACTGTTCCCATGCATGTGGACCATGTTTTCCGTGCAAAAGGGTGATGGTGAGCTTCAAATGCTCTGTTGCAGAGTCTTGTCCAACTGTCTACAGATGCATGTGTAAAGGGAAATATTATCATGTACCCTCCAATTGA ATGGAGTTATACCCTACAGGATCCAGCCTCCCAGACTGTTCCCATGCATGTGGACCATGTTTTCCGTGCAAAAGGGTGATGGTGAGCTTCAAATGCTCTGTTGCAGAGTCTTGTCCAACTGTCTACAGATGCATGTGTAAAGGGAAATATTATCATGTACCCTCCAATTGA MELYPTGSSLPDCSHACGPCFPCKRVMVSFKCSVAESCPTVYRCMCKGKYYHVPSN
BLAST of Cla97C08G151460 vs. NCBI nr
Match: XP_008456675.1 (PREDICTED: protein EPIDERMAL PATTERNING FACTOR 1 [Cucumis melo]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. NCBI nr
Match: XP_022134337.1 (protein EPIDERMAL PATTERNING FACTOR 2-like [Momordica charantia]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. NCBI nr
Match: XP_022957958.1 (protein EPIDERMAL PATTERNING FACTOR 1-like [Cucurbita moschata] >XP_023518828.1 protein EPIDERMAL PATTERNING FACTOR 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. NCBI nr
Match: XP_022990492.1 (protein EPIDERMAL PATTERNING FACTOR 1 [Cucurbita maxima]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. NCBI nr
Match: XP_022992672.1 (protein EPIDERMAL PATTERNING FACTOR 2-like [Cucurbita maxima]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TrEMBL
Match: tr|A0A1S3C3W6|A0A1S3C3W6_CUCME (protein EPIDERMAL PATTERNING FACTOR 1 OS=Cucumis melo OX=3656 GN=LOC103496551 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 6.6e-28 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TrEMBL
Match: tr|A0A061FK47|A0A061FK47_THECC (Membrane lipoprotein OS=Theobroma cacao OX=3641 GN=TCM_036636 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 4.3e-27 Identity = 54/56 (96.43%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TrEMBL
Match: tr|A0A1U8PP01|A0A1U8PP01_GOSHI (protein EPIDERMAL PATTERNING FACTOR 2-like isoform X1 OS=Gossypium hirsutum OX=3635 GN=LOC107961218 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 5.6e-27 Identity = 54/56 (96.43%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TrEMBL
Match: tr|A0A1U8J8W9|A0A1U8J8W9_GOSHI (protein EPIDERMAL PATTERNING FACTOR 2-like OS=Gossypium hirsutum OX=3635 GN=LOC107903116 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 5.6e-27 Identity = 54/56 (96.43%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TrEMBL
Match: tr|A0A1U8PP26|A0A1U8PP26_GOSHI (protein EPIDERMAL PATTERNING FACTOR 2-like isoform X2 OS=Gossypium hirsutum OX=3635 GN=LOC107961218 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 5.6e-27 Identity = 54/56 (96.43%), Postives = 55/56 (98.21%), Query Frame = 0
BLAST of Cla97C08G151460 vs. Swiss-Prot
Match: sp|Q8LC53|EPF2_ARATH (Protein EPIDERMAL PATTERNING FACTOR 2 OS=Arabidopsis thaliana OX=3702 GN=EPF2 PE=1 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 3.9e-23 Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of Cla97C08G151460 vs. Swiss-Prot
Match: sp|C4B8C5|EPFL7_ARATH (EPIDERMAL PATTERNING FACTOR-like protein 7 OS=Arabidopsis thaliana OX=3702 GN=EPFL7 PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.4e-18 Identity = 35/50 (70.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. Swiss-Prot
Match: sp|Q8S8I4|EPF1_ARATH (Protein EPIDERMAL PATTERNING FACTOR 1 OS=Arabidopsis thaliana OX=3702 GN=EPF1 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.8e-12 Identity = 32/51 (62.75%), Postives = 36/51 (70.59%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TAIR10
Match: AT1G34245.1 (Putative membrane lipoprotein) HSP 1 Score: 107.8 bits (268), Expect = 2.1e-24 Identity = 43/55 (78.18%), Postives = 50/55 (90.91%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TAIR10
Match: AT1G71866.1 (LOCATED IN: endomembrane system) HSP 1 Score: 90.5 bits (223), Expect = 3.5e-19 Identity = 35/50 (70.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Cla97C08G151460 vs. TAIR10
Match: AT2G20875.1 (epidermal patterning factor 1) HSP 1 Score: 72.4 bits (176), Expect = 1.0e-13 Identity = 32/51 (62.75%), Postives = 36/51 (70.59%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|