Cla97C05G090890 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGTTTTGAGGGCTTGTTTTGGAATCTATGCTGCTGTGATTATGGCTGTCTTTTATGTTGTTTCTTTGCCTGTGGCTGTATCTGCAGCTGAACATTCATCTTCTCCAGCTCCAGCTCCCACTAGTGATGGTTAGTTTTCTTTTCTTCCTGGTTTTCTCTTTGTTTTGTTTGTTTCTTGAGAAATTTTCTGGGAAAAAGACGGGAAATCCGAGAAAATGGCTTTGAAAATACTCTTCCCTTTAAATTCTAGATTCTAAGAAGCACCAATCAATTCAATTGGGTCTCCTTGAATTGGAAATGGGGTTTGGGGAATTTGGCTCCTTGTTTGAAAAGAAGCAAAATTTACTCCTTTTCTCCCATGCCATTTTTAGACATTTTTCTGTTAGTTTCTTGAGAGGGGACTGACAGGGAATATGAGAATGGCTTTGAAATCAACTCTCATCTTCAAATACAAAGGTGAATCTCCTTAAATTGAAAATGGGTTTCTGGTATTTGAAGAGAAGAGTTGATTTCAAAGGCAAATAGAGTTGTTGGAATTGAATCTCCTTCCTAAATTGGGAAAGTTGACTCCTTGTTTGAATAGAAAACAATATCTACTCTTTTTTCTTCCTCAAGTCAAGAAGAAGAAGCCACCATTTTAGGACATTTTCTTAAAGAAACCTTGCTTAGCTATTAATGGTGTTAAACTCCAAAAATAACATTAATTTGGGATTTCATATGTTGCAGGAACCACAATAGACCAAGGAATAGCATATGTTCTAATGCTGTTGGCTTTAGTGCTCACTTATATCATCCATTGA ATGGCTGTTTTGAGGGCTTGTTTTGGAATCTATGCTGCTGTGATTATGGCTGTCTTTTATGTTGTTTCTTTGCCTGTGGCTGTATCTGCAGCTGAACATTCATCTTCTCCAGCTCCAGCTCCCACTAGTGATGGAACCACAATAGACCAAGGAATAGCATATGTTCTAATGCTGTTGGCTTTAGTGCTCACTTATATCATCCATTGA ATGGCTGTTTTGAGGGCTTGTTTTGGAATCTATGCTGCTGTGATTATGGCTGTCTTTTATGTTGTTTCTTTGCCTGTGGCTGTATCTGCAGCTGAACATTCATCTTCTCCAGCTCCAGCTCCCACTAGTGATGGAACCACAATAGACCAAGGAATAGCATATGTTCTAATGCTGTTGGCTTTAGTGCTCACTTATATCATCCATTGA MAVLRACFGIYAAVIMAVFYVVSLPVAVSAAEHSSSPAPAPTSDGTTIDQGIAYVLMLLALVLTYIIH
BLAST of Cla97C05G090890 vs. NCBI nr
Match: XP_022945187.1 (arabinogalactan peptide 22-like [Cucurbita moschata] >XP_023541894.1 arabinogalactan peptide 22-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.8 bits (242), Expect = 1.5e-17 Identity = 57/68 (83.82%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of Cla97C05G090890 vs. NCBI nr
Match: XP_008465391.1 (PREDICTED: arabinogalactan peptide 22 [Cucumis melo]) HSP 1 Score: 96.3 bits (238), Expect = 4.3e-17 Identity = 58/69 (84.06%), Postives = 65/69 (94.20%), Query Frame = 0
BLAST of Cla97C05G090890 vs. NCBI nr
Match: XP_022140891.1 (arabinogalactan peptide 22-like [Momordica charantia]) HSP 1 Score: 93.2 bits (230), Expect = 3.6e-16 Identity = 54/68 (79.41%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of Cla97C05G090890 vs. NCBI nr
Match: XP_022968217.1 (arabinogalactan peptide 22-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 73.2 bits (178), Expect = 3.9e-10 Identity = 48/70 (68.57%), Postives = 53/70 (75.71%), Query Frame = 0
BLAST of Cla97C05G090890 vs. NCBI nr
Match: XP_022968216.1 (arabinogalactan peptide 22-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 73.2 bits (178), Expect = 3.9e-10 Identity = 48/70 (68.57%), Postives = 53/70 (75.71%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TrEMBL
Match: tr|A0A1S3CNS5|A0A1S3CNS5_CUCME (arabinogalactan peptide 22 OS=Cucumis melo OX=3656 GN=LOC103503022 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.9e-17 Identity = 58/69 (84.06%), Postives = 65/69 (94.20%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TrEMBL
Match: tr|B9RIM3|B9RIM3_RICCO (Uncharacterized protein OS=Ricinus communis OX=3988 GN=RCOM_1580600 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.3e-09 Identity = 41/68 (60.29%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TrEMBL
Match: tr|A0A0A0KZS8|A0A0A0KZS8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G051380 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 4.9e-09 Identity = 42/68 (61.76%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TrEMBL
Match: tr|A0A1U8AFS3|A0A1U8AFS3_NELNU (arabinogalactan peptide 20-like OS=Nelumbo nucifera OX=4432 GN=LOC104603947 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 6.4e-09 Identity = 45/68 (66.18%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TrEMBL
Match: tr|A0A2C9UIZ9|A0A2C9UIZ9_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_14G018800 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.9e-08 Identity = 43/68 (63.24%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of Cla97C05G090890 vs. Swiss-Prot
Match: sp|Q8L9T8|AGP41_ARATH (Arabinogalactan protein 41 OS=Arabidopsis thaliana OX=3702 GN=AGP41 PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 5.9e-10 Identity = 39/68 (57.35%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of Cla97C05G090890 vs. Swiss-Prot
Match: sp|O82337|AGP16_ARATH (Arabinogalactan protein 16 OS=Arabidopsis thaliana OX=3702 GN=AGP16 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.3e-08 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of Cla97C05G090890 vs. Swiss-Prot
Match: sp|Q9M373|AGP20_ARATH (Arabinogalactan protein 20 OS=Arabidopsis thaliana OX=3702 GN=AGP20 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.3e-08 Identity = 31/57 (54.39%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of Cla97C05G090890 vs. Swiss-Prot
Match: sp|Q9FK16|AGP22_ARATH (Arabinogalactan protein 22 OS=Arabidopsis thaliana OX=3702 GN=AGP22 PE=1 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 3.7e-04 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TAIR10
Match: AT5G24105.1 (arabinogalactan protein 41) HSP 1 Score: 64.3 bits (155), Expect = 3.3e-11 Identity = 39/68 (57.35%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TAIR10
Match: AT2G46330.1 (arabinogalactan protein 16) HSP 1 Score: 58.2 bits (139), Expect = 2.4e-09 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TAIR10
Match: AT3G61640.1 (arabinogalactan protein 20) HSP 1 Score: 58.2 bits (139), Expect = 2.4e-09 Identity = 31/57 (54.39%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of Cla97C05G090890 vs. TAIR10
Match: AT5G53250.1 (arabinogalactan protein 22) HSP 1 Score: 45.1 bits (105), Expect = 2.1e-05 Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |