Cla97C01G014520 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTTATTGATGAATGAAGAGTTATTGATTTGCTGCAATGCTTCACCAACCAACAAACAAGCCTTCTTCAAGTTGAAGCCTAAAAAGGGTAATTATTATTATGGTCATTTCTTTGGATTCTTGCCTAGAAGAATTCCCATTCCTGCCTCTGGCCCTTCAAGAAAACACAACGATATTGGCTTAAGAAGCTGGAGATCGCCTTGA ATGTTGTTATTGATGAATGAAGAGTTATTGATTTGCTGCAATGCTTCACCAACCAACAAACAAGCCTTCTTCAAGTTGAAGCCTAAAAAGGGTAATTATTATTATGGTCATTTCTTTGGATTCTTGCCTAGAAGAATTCCCATTCCTGCCTCTGGCCCTTCAAGAAAACACAACGATATTGGCTTAAGAAGCTGGAGATCGCCTTGA ATGTTGTTATTGATGAATGAAGAGTTATTGATTTGCTGCAATGCTTCACCAACCAACAAACAAGCCTTCTTCAAGTTGAAGCCTAAAAAGGGTAATTATTATTATGGTCATTTCTTTGGATTCTTGCCTAGAAGAATTCCCATTCCTGCCTCTGGCCCTTCAAGAAAACACAACGATATTGGCTTAAGAAGCTGGAGATCGCCTTGA MLLLMNEELLICCNASPTNKQAFFKLKPKKGNYYYGHFFGFLPRRIPIPASGPSRKHNDIGLRSWRSP
BLAST of Cla97C01G014520 vs. NCBI nr
Match: ONI01802.1 (hypothetical protein PRUPE_6G159700 [Prunus persica]) HSP 1 Score: 83.2 bits (204), Expect = 3.8e-13 Identity = 42/56 (75.00%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Cla97C01G014520 vs. NCBI nr
Match: XP_007048294.2 (PREDICTED: protein IDA-LIKE 2 [Theobroma cacao]) HSP 1 Score: 81.3 bits (199), Expect = 1.4e-12 Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of Cla97C01G014520 vs. NCBI nr
Match: KJB40456.1 (hypothetical protein B456_007G064600 [Gossypium raimondii]) HSP 1 Score: 80.1 bits (196), Expect = 3.2e-12 Identity = 41/67 (61.19%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of Cla97C01G014520 vs. NCBI nr
Match: XP_015165741.1 (PREDICTED: protein IDA-LIKE 2-like [Solanum tuberosum]) HSP 1 Score: 79.3 bits (194), Expect = 5.5e-12 Identity = 34/57 (59.65%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of Cla97C01G014520 vs. NCBI nr
Match: XP_015057956.1 (PREDICTED: protein IDA-LIKE 2-like [Solanum pennellii]) HSP 1 Score: 79.0 bits (193), Expect = 7.1e-12 Identity = 34/57 (59.65%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TrEMBL
Match: tr|M5W2Q5|M5W2Q5_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G159700 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.5e-13 Identity = 42/56 (75.00%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TrEMBL
Match: tr|A0A0D2SF39|A0A0D2SF39_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_007G064600 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.1e-12 Identity = 41/67 (61.19%), Postives = 46/67 (68.66%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TrEMBL
Match: tr|A0A2P6RS79|A0A2P6RS79_ROSCH (Uncharacterized protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr2g0120121 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 6.2e-12 Identity = 35/45 (77.78%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TrEMBL
Match: tr|A0A1S3E7X2|A0A1S3E7X2_CICAR (protein IDA-LIKE 2-like OS=Cicer arietinum OX=3827 GN=LOC101506104 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.4e-11 Identity = 42/70 (60.00%), Postives = 48/70 (68.57%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TrEMBL
Match: tr|A0A151TLA3|A0A151TLA3_CAJCA (Protein IDA-LIKE 2 OS=Cajanus cajan OX=3821 GN=KK1_024188 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.1e-11 Identity = 36/57 (63.16%), Postives = 43/57 (75.44%), Query Frame = 0
BLAST of Cla97C01G014520 vs. Swiss-Prot
Match: sp|Q6DUW9|IDL2_ARATH (Protein IDA-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=IDL2 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.0e-10 Identity = 35/68 (51.47%), Postives = 38/68 (55.88%), Query Frame = 0
BLAST of Cla97C01G014520 vs. Swiss-Prot
Match: sp|Q6DUW6|IDL4_ARATH (Protein IDA-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=IDL4 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-08 Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of Cla97C01G014520 vs. Swiss-Prot
Match: sp|Q6DUW7|IDL3_ARATH (Protein IDA-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=IDL3 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.4e-05 Identity = 27/81 (33.33%), Postives = 39/81 (48.15%), Query Frame = 0
BLAST of Cla97C01G014520 vs. Swiss-Prot
Match: sp|Q6DUW8|IDL5_ARATH (Protein IDA-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=IDL5 PE=2 SV=2) HSP 1 Score: 45.4 bits (106), Expect = 2.9e-04 Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TAIR10
Match: AT5G64667.1 (inflorescence deficient in abscission (IDA)-like 2) HSP 1 Score: 65.9 bits (159), Expect = 1.1e-11 Identity = 35/68 (51.47%), Postives = 38/68 (55.88%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TAIR10
Match: AT3G18715.1 (inflorescence deficient in abscission (IDA)-like 4) HSP 1 Score: 60.1 bits (144), Expect = 6.2e-10 Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TAIR10
Match: AT5G09805.1 (inflorescence deficient in abscission (IDA)-like 3) HSP 1 Score: 48.1 bits (113), Expect = 2.4e-06 Identity = 27/81 (33.33%), Postives = 39/81 (48.15%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TAIR10
Match: AT1G76952.1 (inflorescence deficient in abscission (IDA)-like 5) HSP 1 Score: 45.4 bits (106), Expect = 1.6e-05 Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 0
BLAST of Cla97C01G014520 vs. TAIR10
Match: AT1G68765.1 (Putative membrane lipoprotein) HSP 1 Score: 40.8 bits (94), Expect = 3.9e-04 Identity = 17/47 (36.17%), Postives = 25/47 (53.19%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |