Cla97C01G010520 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAAGCATCAGAAATTCAATCCTGAAACACATGAGGATCAGAGGACCTAATACTACAACACAGTTGTTGATGAAGGATGAGAATGTAATGGAGAAACTAACTCGCCATTTGTGCACATCAAAATGTACAAGCACTGATGAAATAGTTGATCGAGTGATTGGATTGGTTAAGAAGTTTGATAGAATCGACGCCTGTAAGGTAATTAGTCGAGGGCCAGCCTATCATCTCATCTTTGAACTTTTAAACTTTATTCAGGATTTCTGTGGATTCCCTCCTAATTATCGGATTCTATTAAATACAATACAATATATTTCTTAACATTTAATGTCGTGTTGAGCTGAGCAGGTTACTGAAACGGCTGATTTCCAGAAGGACTTAAGCCTGGACAGCTTGGACAGGGTGGAGCTTGTTATGGCTTTTGAACAAGAATTCTCCATTGAAATCCCAGATGAACAGGCAGATAAGCTTACGTGCTGTGCAGATGTAGCACGATACATAACTTCTCAAGTAGAGGAAAAGAAAGAGGAGAAACTCTGA ATGCAAAGCATCAGAAATTCAATCCTGAAACACATGAGGATCAGAGGACCTAATACTACAACACAGTTGTTGATGAAGGATGAGAATGTAATGGAGAAACTAACTCGCCATTTGTGCACATCAAAATGTACAAGCACTGATGAAATAGTTGATCGAGTGATTGGATTGGTTAAGAAGTTTGATAGAATCGACGCCTGTAAGGTTACTGAAACGGCTGATTTCCAGAAGGACTTAAGCCTGGACAGCTTGGACAGGGTGGAGCTTGTTATGGCTTTTGAACAAGAATTCTCCATTGAAATCCCAGATGAACAGGCAGATAAGCTTACGTGCTGTGCAGATGTAGCACGATACATAACTTCTCAAGTAGAGGAAAAGAAAGAGGAGAAACTCTGA ATGCAAAGCATCAGAAATTCAATCCTGAAACACATGAGGATCAGAGGACCTAATACTACAACACAGTTGTTGATGAAGGATGAGAATGTAATGGAGAAACTAACTCGCCATTTGTGCACATCAAAATGTACAAGCACTGATGAAATAGTTGATCGAGTGATTGGATTGGTTAAGAAGTTTGATAGAATCGACGCCTGTAAGGTTACTGAAACGGCTGATTTCCAGAAGGACTTAAGCCTGGACAGCTTGGACAGGGTGGAGCTTGTTATGGCTTTTGAACAAGAATTCTCCATTGAAATCCCAGATGAACAGGCAGATAAGCTTACGTGCTGTGCAGATGTAGCACGATACATAACTTCTCAAGTAGAGGAAAAGAAAGAGGAGAAACTCTGA MQSIRNSILKHMRIRGPNTTTQLLMKDENVMEKLTRHLCTSKCTSTDEIVDRVIGLVKKFDRIDACKVTETADFQKDLSLDSLDRVELVMAFEQEFSIEIPDEQADKLTCCADVARYITSQVEEKKEEKL
BLAST of Cla97C01G010520 vs. NCBI nr
Match: XP_023001631.1 (acyl carrier protein 3, mitochondrial [Cucurbita maxima] >XP_023001632.1 acyl carrier protein 3, mitochondrial [Cucurbita maxima]) HSP 1 Score: 227.3 bits (578), Expect = 3.1e-56 Identity = 117/129 (90.70%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cla97C01G010520 vs. NCBI nr
Match: XP_022927340.1 (acyl carrier protein 3, mitochondrial isoform X2 [Cucurbita moschata]) HSP 1 Score: 226.1 bits (575), Expect = 6.9e-56 Identity = 116/129 (89.92%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cla97C01G010520 vs. NCBI nr
Match: XP_022927338.1 (acyl carrier protein 3, mitochondrial isoform X1 [Cucurbita moschata]) HSP 1 Score: 226.1 bits (575), Expect = 6.9e-56 Identity = 116/129 (89.92%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cla97C01G010520 vs. NCBI nr
Match: XP_023520171.1 (acyl carrier protein 3, mitochondrial [Cucurbita pepo subsp. pepo] >XP_023520172.1 acyl carrier protein 3, mitochondrial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 224.2 bits (570), Expect = 2.6e-55 Identity = 116/129 (89.92%), Postives = 122/129 (94.57%), Query Frame = 0
BLAST of Cla97C01G010520 vs. NCBI nr
Match: XP_008463599.1 (PREDICTED: acyl carrier protein 3, mitochondrial isoform X2 [Cucumis melo] >XP_008463600.1 PREDICTED: acyl carrier protein 3, mitochondrial isoform X2 [Cucumis melo]) HSP 1 Score: 223.8 bits (569), Expect = 3.4e-55 Identity = 116/130 (89.23%), Postives = 123/130 (94.62%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TrEMBL
Match: tr|A0A1S3CK44|A0A1S3CK44_CUCME (Acyl carrier protein OS=Cucumis melo OX=3656 GN=LOC103501710 PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 2.3e-55 Identity = 116/130 (89.23%), Postives = 123/130 (94.62%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TrEMBL
Match: tr|A0A1S4E499|A0A1S4E499_CUCME (Acyl carrier protein OS=Cucumis melo OX=3656 GN=LOC103501710 PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 2.3e-55 Identity = 116/130 (89.23%), Postives = 123/130 (94.62%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TrEMBL
Match: tr|A0A0A0LVR9|A0A0A0LVR9_CUCSA (Acyl carrier protein OS=Cucumis sativus OX=3659 GN=Csa_1G181370 PE=3 SV=1) HSP 1 Score: 222.6 bits (566), Expect = 5.0e-55 Identity = 115/130 (88.46%), Postives = 122/130 (93.85%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TrEMBL
Match: tr|A0A2P4JSE9|A0A2P4JSE9_QUESU (Acyl carrier protein OS=Quercus suber OX=58331 GN=CFP56_31407 PE=3 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 3.0e-39 Identity = 86/125 (68.80%), Postives = 108/125 (86.40%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TrEMBL
Match: tr|M5WHZ2|M5WHZ2_PRUPE (Acyl carrier protein OS=Prunus persica OX=3760 GN=PRUPE_4G004400 PE=3 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 5.1e-39 Identity = 90/126 (71.43%), Postives = 107/126 (84.92%), Query Frame = 0
BLAST of Cla97C01G010520 vs. Swiss-Prot
Match: sp|Q9FGJ4|ACPM3_ARATH (Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 4.1e-28 Identity = 72/131 (54.96%), Postives = 92/131 (70.23%), Query Frame = 0
BLAST of Cla97C01G010520 vs. Swiss-Prot
Match: sp|P53665|ACPM1_ARATH (Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP1 PE=1 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 9.6e-17 Identity = 47/116 (40.52%), Postives = 69/116 (59.48%), Query Frame = 0
BLAST of Cla97C01G010520 vs. Swiss-Prot
Match: sp|O80800|ACPM2_ARATH (Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.8e-14 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of Cla97C01G010520 vs. Swiss-Prot
Match: sp|Q54E22|ACPM_DICDI (Acyl carrier protein, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=ndufab1 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.8e-14 Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Cla97C01G010520 vs. Swiss-Prot
Match: sp|Q10217|ACPM_SCHPO (Putative acyl carrier protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.09 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.8e-13 Identity = 40/75 (53.33%), Postives = 51/75 (68.00%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TAIR10
Match: AT5G47630.1 (mitochondrial acyl carrier protein 3) HSP 1 Score: 125.6 bits (314), Expect = 2.3e-29 Identity = 72/131 (54.96%), Postives = 92/131 (70.23%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TAIR10
Match: AT2G44620.1 (mitochondrial acyl carrier protein 1) HSP 1 Score: 87.8 bits (216), Expect = 5.3e-18 Identity = 47/116 (40.52%), Postives = 69/116 (59.48%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TAIR10
Match: AT1G65290.1 (mitochondrial acyl carrier protein 2) HSP 1 Score: 78.6 bits (192), Expect = 3.2e-15 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TAIR10
Match: AT3G05020.1 (acyl carrier protein 1) HSP 1 Score: 52.8 bits (125), Expect = 1.9e-07 Identity = 30/98 (30.61%), Postives = 48/98 (48.98%), Query Frame = 0
BLAST of Cla97C01G010520 vs. TAIR10
Match: AT5G27200.1 (acyl carrier protein 5) HSP 1 Score: 48.5 bits (114), Expect = 3.6e-06 Identity = 32/84 (38.10%), Postives = 44/84 (52.38%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|