Cla016475 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATAACTCTCAAAAGATGAGCTACCACGCTGGAGAAGCCAAGGGTCAAGCTCAGGTTCACACCTACCCATCATCATTTATTGATTGCATGTTTAATTATTGTATTTTTAATATACATTATGGTAATTGAATATAAAATGAATTTGGTAATAATTGCCAAATATAATAATTTAATTCCCAATATTTGTGTTATCTTTTAATGCCATTTTTTATTCTTTTATTTCATGGATTTTATATTGCTTTATTGGTTGTCATCAGAAAATGCCTTATATTTGGTTTATGTTGGTGTGATTATAAAAGGGTGATAGAGTAACATGTTAATTAGTTTGTCTTTATTTAGGAGAAGGTGAGCAATATGATGGACAAGGCAAGTGATGTAGCCCAATCAGCTAAGGAATCCGTGCAAGAAGCAGGACAACAGGTGAAAGCTAAGGCACAAGGAGCTGCCGATGCTGTCAAAGATGCAATTAACAAATGA ATGGATAACTCTCAAAAGATGAGCTACCACGCTGGAGAAGCCAAGGGTCAAGCTCAGGAGAAGGTGAGCAATATGATGGACAAGGCAAGTGATGTAGCCCAATCAGCTAAGGAATCCGTGCAAGAAGCAGGACAACAGGTGAAAGCTAAGGCACAAGGAGCTGCCGATGCTGTCAAAGATGCAATTAACAAATGA ATGGATAACTCTCAAAAGATGAGCTACCACGCTGGAGAAGCCAAGGGTCAAGCTCAGGAGAAGGTGAGCAATATGATGGACAAGGCAAGTGATGTAGCCCAATCAGCTAAGGAATCCGTGCAAGAAGCAGGACAACAGGTGAAAGCTAAGGCACAAGGAGCTGCCGATGCTGTCAAAGATGCAATTAACAAATGA MDNSQKMSYHAGEAKGQAQEKVSNMMDKASDVAQSAKESVQEAGQQVKAKAQGAADAVKDAINK
BLAST of Cla016475 vs. Swiss-Prot
Match: LEA2_CICAR (Late embryogenesis abundant protein 2 OS=Cicer arietinum PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.3e-06 Identity = 26/57 (45.61%), Postives = 31/57 (54.39%), Query Frame = 1
HSP 2 Score: 47.4 bits (111), Expect = 7.0e-05 Identity = 26/68 (38.24%), Postives = 33/68 (48.53%), Query Frame = 1
HSP 3 Score: 44.3 bits (103), Expect = 5.9e-04 Identity = 27/79 (34.18%), Postives = 33/79 (41.77%), Query Frame = 1
HSP 4 Score: 41.6 bits (96), Expect = 3.8e-03 Identity = 23/60 (38.33%), Postives = 32/60 (53.33%), Query Frame = 1
HSP 5 Score: 35.0 bits (79), Expect = 3.6e-01 Identity = 27/90 (30.00%), Postives = 33/90 (36.67%), Query Frame = 1
BLAST of Cla016475 vs. Swiss-Prot
Match: KIN2_ARATH (Stress-induced protein KIN2 OS=Arabidopsis thaliana GN=KIN2 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 4.8e-06 Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 1
BLAST of Cla016475 vs. TrEMBL
Match: A0A0A0KXN2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643250 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.1e-22 Identity = 56/63 (88.89%), Postives = 59/63 (93.65%), Query Frame = 1
BLAST of Cla016475 vs. TrEMBL
Match: A0A0A0KRE1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165860 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-20 Identity = 52/60 (86.67%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of Cla016475 vs. TrEMBL
Match: B9T3S3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0447160 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.2e-19 Identity = 51/60 (85.00%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of Cla016475 vs. TrEMBL
Match: A0A0A0KPD4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165870 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 2.0e-19 Identity = 51/60 (85.00%), Postives = 54/60 (90.00%), Query Frame = 1
BLAST of Cla016475 vs. TrEMBL
Match: A0A0A0KSI8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643240 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.3e-18 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cla016475 vs. NCBI nr
Match: gi|449447458|ref|XP_004141485.1| (PREDICTED: late embryogenesis abundant protein 2-like [Cucumis sativus]) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-22 Identity = 56/63 (88.89%), Postives = 59/63 (93.65%), Query Frame = 1
BLAST of Cla016475 vs. NCBI nr
Match: gi|659119052|ref|XP_008459449.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 112.8 bits (281), Expect = 2.2e-22 Identity = 56/64 (87.50%), Postives = 59/64 (92.19%), Query Frame = 1
BLAST of Cla016475 vs. NCBI nr
Match: gi|659073373|ref|XP_008437025.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 110.2 bits (274), Expect = 1.4e-21 Identity = 55/60 (91.67%), Postives = 57/60 (95.00%), Query Frame = 1
BLAST of Cla016475 vs. NCBI nr
Match: gi|1009127017|ref|XP_015880470.1| (PREDICTED: stress-induced protein KIN2-like [Ziziphus jujuba]) HSP 1 Score: 107.8 bits (268), Expect = 6.9e-21 Identity = 54/60 (90.00%), Postives = 57/60 (95.00%), Query Frame = 1
BLAST of Cla016475 vs. NCBI nr
Match: gi|659119054|ref|XP_008459450.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-20 Identity = 52/63 (82.54%), Postives = 58/63 (92.06%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|