Cla009179 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGGACTTCTGCCATTTGAGTCTACACATCATAGAATATCTGATGGTGGGTCCTCAAAGAGTTCTCAAGAAAAGCAAGATGAAGCAGGTCGTTGGTATATGTCCAGAAAGGAAATTGAAGAAAATTCCCCATCAAGAAGAGATGGTATTGACTTGAAGAAGGAGACTTATTTACGGAAGTCATACTGCACATTTTTGCAAGATCTGGGCATGAGGCTCAAAGTGTAA ATGTCTGGACTTCTGCCATTTGAGTCTACACATCATAGAATATCTGATGGTGGGTCCTCAAAGAGTTCTCAAGAAAAGCAAGATGAAGCAGGTCGTTGGTATATGTCCAGAAAGGAAATTGAAGAAAATTCCCCATCAAGAAGAGATGGTATTGACTTGAAGAAGGAGACTTATTTACGGAAGTCATACTGCACATTTTTGCAAGATCTGGGCATGAGGCTCAAAGTGTAA ATGTCTGGACTTCTGCCATTTGAGTCTACACATCATAGAATATCTGATGGTGGGTCCTCAAAGAGTTCTCAAGAAAAGCAAGATGAAGCAGGTCGTTGGTATATGTCCAGAAAGGAAATTGAAGAAAATTCCCCATCAAGAAGAGATGGTATTGACTTGAAGAAGGAGACTTATTTACGGAAGTCATACTGCACATTTTTGCAAGATCTGGGCATGAGGCTCAAAGTGTAA MSGLLPFESTHHRISDGGSSKSSQEKQDEAGRWYMSRKEIEENSPSRRDGIDLKKETYLRKSYCTFLQDLGMRLKV
BLAST of Cla009179 vs. Swiss-Prot
Match: CCT15_ARATH (Cyclin-T1-5 OS=Arabidopsis thaliana GN=CYCT1-5 PE=1 SV=2) HSP 1 Score: 107.8 bits (268), Expect = 5.2e-23 Identity = 52/76 (68.42%), Postives = 57/76 (75.00%), Query Frame = 1
BLAST of Cla009179 vs. Swiss-Prot
Match: CCT14_ORYSJ (Cyclin-T1-4 OS=Oryza sativa subsp. japonica GN=CYCT1-1 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.6e-22 Identity = 50/77 (64.94%), Postives = 59/77 (76.62%), Query Frame = 1
BLAST of Cla009179 vs. Swiss-Prot
Match: CCT14_ARATH (Cyclin-T1-4 OS=Arabidopsis thaliana GN=CYCT1-4 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.4e-22 Identity = 51/76 (67.11%), Postives = 55/76 (72.37%), Query Frame = 1
BLAST of Cla009179 vs. Swiss-Prot
Match: CCT13_ORYSJ (Cyclin-T1-3 OS=Oryza sativa subsp. japonica GN=CYCT1-3 PE=3 SV=2) HSP 1 Score: 98.2 bits (243), Expect = 4.1e-20 Identity = 49/80 (61.25%), Postives = 57/80 (71.25%), Query Frame = 1
BLAST of Cla009179 vs. Swiss-Prot
Match: CCT12_ARATH (Cyclin-T1-2 OS=Arabidopsis thaliana GN=CYCT1-2 PE=2 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-13 Identity = 39/58 (67.24%), Postives = 41/58 (70.69%), Query Frame = 1
BLAST of Cla009179 vs. TrEMBL
Match: A0A0A0M1B5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G714690 PE=3 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 2.7e-34 Identity = 73/76 (96.05%), Postives = 74/76 (97.37%), Query Frame = 1
BLAST of Cla009179 vs. TrEMBL
Match: A0A0D2VID7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_011G051300 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.7e-28 Identity = 62/76 (81.58%), Postives = 69/76 (90.79%), Query Frame = 1
BLAST of Cla009179 vs. TrEMBL
Match: A0A061GC57_THECC (Cyclin family protein, putative isoform 1 OS=Theobroma cacao GN=TCM_029312 PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.8e-28 Identity = 61/76 (80.26%), Postives = 69/76 (90.79%), Query Frame = 1
BLAST of Cla009179 vs. TrEMBL
Match: A0A0B2S8F2_GLYSO (Cyclin-T1-5 OS=Glycine soja GN=glysoja_007496 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.6e-26 Identity = 62/77 (80.52%), Postives = 69/77 (89.61%), Query Frame = 1
BLAST of Cla009179 vs. TrEMBL
Match: K7L395_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_07G223700 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.6e-26 Identity = 62/77 (80.52%), Postives = 69/77 (89.61%), Query Frame = 1
BLAST of Cla009179 vs. NCBI nr
Match: gi|659118350|ref|XP_008459075.1| (PREDICTED: LOW QUALITY PROTEIN: cyclin-T1-5 [Cucumis melo]) HSP 1 Score: 152.5 bits (384), Expect = 2.9e-34 Identity = 73/76 (96.05%), Postives = 75/76 (98.68%), Query Frame = 1
BLAST of Cla009179 vs. NCBI nr
Match: gi|778664653|ref|XP_011660325.1| (PREDICTED: cyclin-T1-3 [Cucumis sativus]) HSP 1 Score: 152.1 bits (383), Expect = 3.8e-34 Identity = 73/76 (96.05%), Postives = 74/76 (97.37%), Query Frame = 1
BLAST of Cla009179 vs. NCBI nr
Match: gi|823245164|ref|XP_012455251.1| (PREDICTED: cyclin-T1-4 [Gossypium raimondii]) HSP 1 Score: 132.9 bits (333), Expect = 2.4e-28 Identity = 62/76 (81.58%), Postives = 69/76 (90.79%), Query Frame = 1
BLAST of Cla009179 vs. NCBI nr
Match: gi|590621708|ref|XP_007024847.1| (Cyclin family protein, putative isoform 1 [Theobroma cacao]) HSP 1 Score: 132.1 bits (331), Expect = 4.1e-28 Identity = 61/76 (80.26%), Postives = 69/76 (90.79%), Query Frame = 1
BLAST of Cla009179 vs. NCBI nr
Match: gi|356521602|ref|XP_003529443.1| (PREDICTED: cyclin-T1-3-like isoform X1 [Glycine max]) HSP 1 Score: 126.3 bits (316), Expect = 2.2e-26 Identity = 62/77 (80.52%), Postives = 69/77 (89.61%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|