Cla004646 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCAACTACATGAACCCCTTCTTCACTCTCCTCCTTCTCGCCACCTCCCTCTTCGCCGTCGCTTCTTTTGAGTTCCAAGTCGGTGGCGTCAAAGGCTGGGTGGTTCCGCCGGTTAACGACACCAAAATCTACAACGATTGGGCCTCAGAAAACAGATTCACAGCCGGTGACACCATCCGTAAGTTCCGATCATCTCGACAACACCCAATCGATTAAACTTCCCTTTCCACATTCACACTGTCTCTGTTTGTTGGTTGTTTTTGGAATAGGTTTCCGGTACAAGAAGGATTCCGTGATGGAAGTGACAGAAGAAGAGTACAAAAGATGCAACTCCACACAGCCGAGTTTCTTCTCCAATACCGGCAACACAGTCTTCCAACTCGGCCGATCGGGAACTTTCTACTTCATCAGCGGCGCTTATGGCCACTGCGAGAGAGGGCAGAGGATGATCGTGAAGGTGATGGCCGAAGATGAATCTTCCTCTTCCTCCCATTCTGAGAAATCCTCTGCGGTGATGGCTCCAATTTCGTCGTTAGGGTTTCTAAAATTCGTCTCTGCTCCCATGGCTCTGTCCATTCTGTTTTAG ATGGCTTCCAACTACATGAACCCCTTCTTCACTCTCCTCCTTCTCGCCACCTCCCTCTTCGCCGTCGCTTCTTTTGAGTTCCAAGTCGGTGGCGTCAAAGGCTGGGTGGTTCCGCCGGTTAACGACACCAAAATCTACAACGATTGGGCCTCAGAAAACAGATTCACAGCCGGTGACACCATCCGTTTCCGGTACAAGAAGGATTCCGTGATGGAAGTGACAGAAGAAGAGTACAAAAGATGCAACTCCACACAGCCGAGTTTCTTCTCCAATACCGGCAACACAGTCTTCCAACTCGGCCGATCGGGAACTTTCTACTTCATCAGCGGCGCTTATGGCCACTGCGAGAGAGGGCAGAGGATGATCGTGAAGGTGATGGCCGAAGATGAATCTTCCTCTTCCTCCCATTCTGAGAAATCCTCTGCGGTGATGGCTCCAATTTCGTCGTTAGGGTTTCTAAAATTCGTCTCTGCTCCCATGGCTCTGTCCATTCTGTTTTAG ATGGCTTCCAACTACATGAACCCCTTCTTCACTCTCCTCCTTCTCGCCACCTCCCTCTTCGCCGTCGCTTCTTTTGAGTTCCAAGTCGGTGGCGTCAAAGGCTGGGTGGTTCCGCCGGTTAACGACACCAAAATCTACAACGATTGGGCCTCAGAAAACAGATTCACAGCCGGTGACACCATCCGTTTCCGGTACAAGAAGGATTCCGTGATGGAAGTGACAGAAGAAGAGTACAAAAGATGCAACTCCACACAGCCGAGTTTCTTCTCCAATACCGGCAACACAGTCTTCCAACTCGGCCGATCGGGAACTTTCTACTTCATCAGCGGCGCTTATGGCCACTGCGAGAGAGGGCAGAGGATGATCGTGAAGGTGATGGCCGAAGATGAATCTTCCTCTTCCTCCCATTCTGAGAAATCCTCTGCGGTGATGGCTCCAATTTCGTCGTTAGGGTTTCTAAAATTCGTCTCTGCTCCCATGGCTCTGTCCATTCTGTTTTAG MASNYMNPFFTLLLLATSLFAVASFEFQVGGVKGWVVPPVNDTKIYNDWASENRFTAGDTIRFRYKKDSVMEVTEEEYKRCNSTQPSFFSNTGNTVFQLGRSGTFYFISGAYGHCERGQRMIVKVMAEDESSSSSHSEKSSAVMAPISSLGFLKFVSAPMALSILF
BLAST of Cla004646 vs. Swiss-Prot
Match: ENL1_ARATH (Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2) HSP 1 Score: 100.9 bits (250), Expect = 1.4e-20 Identity = 59/134 (44.03%), Postives = 79/134 (58.96%), Query Frame = 1
BLAST of Cla004646 vs. Swiss-Prot
Match: ENL2_ARATH (Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 6.4e-18 Identity = 59/166 (35.54%), Postives = 87/166 (52.41%), Query Frame = 1
BLAST of Cla004646 vs. Swiss-Prot
Match: ENL3_ARATH (Early nodulin-like protein 3 OS=Arabidopsis thaliana GN=At5g25090 PE=1 SV=2) HSP 1 Score: 87.8 bits (216), Expect = 1.2e-16 Identity = 52/145 (35.86%), Postives = 80/145 (55.17%), Query Frame = 1
BLAST of Cla004646 vs. Swiss-Prot
Match: ENL1_ORYSJ (Early nodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=ENODL1 PE=1 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.9e-15 Identity = 51/147 (34.69%), Postives = 74/147 (50.34%), Query Frame = 1
BLAST of Cla004646 vs. Swiss-Prot
Match: MAVI_CUCPE (Mavicyanin OS=Cucurbita pepo PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 2.5e-14 Identity = 44/110 (40.00%), Postives = 61/110 (55.45%), Query Frame = 1
BLAST of Cla004646 vs. TrEMBL
Match: A0A0A0KUB3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G517780 PE=4 SV=1) HSP 1 Score: 249.2 bits (635), Expect = 3.5e-63 Identity = 124/158 (78.48%), Postives = 133/158 (84.18%), Query Frame = 1
BLAST of Cla004646 vs. TrEMBL
Match: B9SLS7_RICCO (Mavicyanin, putative OS=Ricinus communis GN=RCOM_0530970 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 1.6e-47 Identity = 105/176 (59.66%), Postives = 127/176 (72.16%), Query Frame = 1
BLAST of Cla004646 vs. TrEMBL
Match: V4TJ30_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10017887mg PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 2.1e-47 Identity = 100/152 (65.79%), Postives = 115/152 (75.66%), Query Frame = 1
BLAST of Cla004646 vs. TrEMBL
Match: A0A067E373_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g038631mg PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 2.1e-47 Identity = 100/152 (65.79%), Postives = 115/152 (75.66%), Query Frame = 1
BLAST of Cla004646 vs. TrEMBL
Match: M5WVK8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa017985mg PE=4 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 6.0e-47 Identity = 96/153 (62.75%), Postives = 120/153 (78.43%), Query Frame = 1
BLAST of Cla004646 vs. NCBI nr
Match: gi|659117915|ref|XP_008458853.1| (PREDICTED: early nodulin-like protein 1 [Cucumis melo]) HSP 1 Score: 265.8 bits (678), Expect = 5.2e-68 Identity = 133/160 (83.12%), Postives = 141/160 (88.12%), Query Frame = 1
BLAST of Cla004646 vs. NCBI nr
Match: gi|700196154|gb|KGN51331.1| (hypothetical protein Csa_5G517780 [Cucumis sativus]) HSP 1 Score: 249.2 bits (635), Expect = 5.0e-63 Identity = 124/158 (78.48%), Postives = 133/158 (84.18%), Query Frame = 1
BLAST of Cla004646 vs. NCBI nr
Match: gi|778708582|ref|XP_004142840.2| (PREDICTED: early nodulin-like protein 1 [Cucumis sativus]) HSP 1 Score: 249.2 bits (635), Expect = 5.0e-63 Identity = 124/158 (78.48%), Postives = 133/158 (84.18%), Query Frame = 1
BLAST of Cla004646 vs. NCBI nr
Match: gi|694389383|ref|XP_009370321.1| (PREDICTED: mavicyanin-like [Pyrus x bretschneideri]) HSP 1 Score: 206.5 bits (524), Expect = 3.7e-50 Identity = 99/144 (68.75%), Postives = 112/144 (77.78%), Query Frame = 1
BLAST of Cla004646 vs. NCBI nr
Match: gi|1009124290|ref|XP_015878987.1| (PREDICTED: stellacyanin-like [Ziziphus jujuba]) HSP 1 Score: 206.1 bits (523), Expect = 4.8e-50 Identity = 103/159 (64.78%), Postives = 117/159 (73.58%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|