Cla001975 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTTTCACCGCCGTTAACCCTAACAAAGTCGGAATCAAGTACGGCGAGTCCCGCTTCACGGTTATGTACCGAGGAATTCCGCTTGGGAGAGCCTCCGTTCCTGGATTCTTTCAAGACCCTCACAGCCAGCGCCAGGTCGATGCTACCATCGCCGTCGATCGCGTTAATCTCCTTCAGGCTGACGCTGCCGATTTGATCCGTGATGCCTCGTTGAACGACCGCGTCGAGCTTAGAATACTCGGCGATGTTGCTGCTAAGATCCGCCTCTTGTCCTTCAATTCCCCCGGCGTTCAGGTACTACTACTCTCTCTACGTCGCCTCTCTGCTTTAGGGATATCCTTGTAA ATGATTTTCACCGCCGTTAACCCTAACAAAGTCGGAATCAAGTACGGCGAGTCCCGCTTCACGGTTATGTACCGAGGAATTCCGCTTGGGAGAGCCTCCGTTCCTGGATTCTTTCAAGACCCTCACAGCCAGCGCCAGGTCGATGCTACCATCGCCGTCGATCGCGTTAATCTCCTTCAGGCTGACGCTGCCGATTTGATCCGTGATGCCTCGTTGAACGACCGCGTCGAGCTTAGAATACTCGGCGATGTTGCTGCTAAGATCCGCCTCTTGTCCTTCAATTCCCCCGGCGTTCAGGTACTACTACTCTCTCTACGTCGCCTCTCTGCTTTAGGGATATCCTTGTAA ATGATTTTCACCGCCGTTAACCCTAACAAAGTCGGAATCAAGTACGGCGAGTCCCGCTTCACGGTTATGTACCGAGGAATTCCGCTTGGGAGAGCCTCCGTTCCTGGATTCTTTCAAGACCCTCACAGCCAGCGCCAGGTCGATGCTACCATCGCCGTCGATCGCGTTAATCTCCTTCAGGCTGACGCTGCCGATTTGATCCGTGATGCCTCGTTGAACGACCGCGTCGAGCTTAGAATACTCGGCGATGTTGCTGCTAAGATCCGCCTCTTGTCCTTCAATTCCCCCGGCGTTCAGGTACTACTACTCTCTCTACGTCGCCTCTCTGCTTTAGGGATATCCTTGTAA MIFTAVNPNKVGIKYGESRFTVMYRGIPLGRASVPGFFQDPHSQRQVDATIAVDRVNLLQADAADLIRDASLNDRVELRILGDVAAKIRLLSFNSPGVQVLLLSLRRLSALGISL
BLAST of Cla001975 vs. TrEMBL
Match: A0A0A0K5H7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G223380 PE=4 SV=1) HSP 1 Score: 193.7 bits (491), Expect = 1.2e-46 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 1
BLAST of Cla001975 vs. TrEMBL
Match: W9RV36_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_024155 PE=4 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 4.4e-41 Identity = 87/100 (87.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla001975 vs. TrEMBL
Match: M5Y567_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010161mg PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 7.5e-41 Identity = 86/100 (86.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla001975 vs. TrEMBL
Match: A0A061DZ99_THECC (Late embryogenesis abundant hydroxyproline-rich glycoprotein family isoform 1 OS=Theobroma cacao GN=TCM_006430 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 7.5e-41 Identity = 85/100 (85.00%), Postives = 94/100 (94.00%), Query Frame = 1
BLAST of Cla001975 vs. TrEMBL
Match: A0A061DYB0_THECC (Late embryogenesis abundant hydroxyproline-rich glycoprotein family isoform 2 (Fragment) OS=Theobroma cacao GN=TCM_006430 PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 2.2e-40 Identity = 84/99 (84.85%), Postives = 93/99 (93.94%), Query Frame = 1
BLAST of Cla001975 vs. NCBI nr
Match: gi|659092733|ref|XP_008447190.1| (PREDICTED: uncharacterized protein LOC103489700 isoform X1 [Cucumis melo]) HSP 1 Score: 199.1 bits (505), Expect = 4.1e-48 Identity = 102/104 (98.08%), Postives = 103/104 (99.04%), Query Frame = 1
BLAST of Cla001975 vs. NCBI nr
Match: gi|449444084|ref|XP_004139805.1| (PREDICTED: uncharacterized protein LOC101207234 [Cucumis sativus]) HSP 1 Score: 193.7 bits (491), Expect = 1.7e-46 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 1
BLAST of Cla001975 vs. NCBI nr
Match: gi|659092735|ref|XP_008447191.1| (PREDICTED: uncharacterized protein LOC103489700 isoform X2 [Cucumis melo]) HSP 1 Score: 193.7 bits (491), Expect = 1.7e-46 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 1
BLAST of Cla001975 vs. NCBI nr
Match: gi|703127528|ref|XP_010103853.1| (hypothetical protein L484_024155 [Morus notabilis]) HSP 1 Score: 175.3 bits (443), Expect = 6.4e-41 Identity = 87/100 (87.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla001975 vs. NCBI nr
Match: gi|645223834|ref|XP_008218823.1| (PREDICTED: uncharacterized protein LOC103319102 [Prunus mume]) HSP 1 Score: 174.5 bits (441), Expect = 1.1e-40 Identity = 86/100 (86.00%), Postives = 96/100 (96.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|