ClCG02G021440 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAGTATTGAAGCGCTATGTGCTGCGATTATTCATATCTTTGAAGTACATAACAGCTAATGTGGTAGATAGAAACAATGGACGGATTGTTGCAACTGCGTCCACAGTTGAACACTCCATCAAGGGCTCACTTGAATGTGGCCGGTCATGTAACGCTAAGGCAGCAGCAGTTGTTGGAGAGGTGTTGGCTATGCGACTCAAAGTTGATGGTCTCGAACAGGGGCAAGGCAGAGGGATTCACGTGGACATAAACAAGGAAGTAGAGAAGAAAGGCTTCAAAAACCGCACAAAAATCTGGGCTATAGTGAACTCACTCAAGAATAACGGAGTTAAACTAATACTCGACAACAATGTAGATGATGCATCTCGGTCGAGTTATCAATAA ATGACAGTATTGAAGCGCTATGTGCTGCGATTATTCATATCTTTGAAGTACATAACAGCTAATGTGGTAGATAGAAACAATGGACGGATTGTTGCAACTGCGTCCACAGTTGAACACTCCATCAAGGGCTCACTTGAATGTGGCCGGTCATGTAACGCTAAGGCAGCAGCAGTTGTTGGAGAGGTGTTGGCTATGCGACTCAAAGTTGATGGTCTCGAACAGGGGCAAGGCAGAGGGATTCACGTGGACATAAACAAGGAAGTAGAGAAGAAAGGCTTCAAAAACCGCACAAAAATCTGGGCTATAGTGAACTCACTCAAGAATAACGGAGTTAAACTAATACTCGACAACAATGTAGATGATGCATCTCGGTCGAGTTATCAATAA ATGACAGTATTGAAGCGCTATGTGCTGCGATTATTCATATCTTTGAAGTACATAACAGCTAATGTGGTAGATAGAAACAATGGACGGATTGTTGCAACTGCGTCCACAGTTGAACACTCCATCAAGGGCTCACTTGAATGTGGCCGGTCATGTAACGCTAAGGCAGCAGCAGTTGTTGGAGAGGTGTTGGCTATGCGACTCAAAGTTGATGGTCTCGAACAGGGGCAAGGCAGAGGGATTCACGTGGACATAAACAAGGAAGTAGAGAAGAAAGGCTTCAAAAACCGCACAAAAATCTGGGCTATAGTGAACTCACTCAAGAATAACGGAGTTAAACTAATACTCGACAACAATGTAGATGATGCATCTCGGTCGAGTTATCAATAA MTVLKRYVLRLFISLKYITANVVDRNNGRIVATASTVEHSIKGSLECGRSCNAKAAAVVGEVLAMRLKVDGLEQGQGRGIHVDINKEVEKKGFKNRTKIWAIVNSLKNNGVKLILDNNVDDASRSSYQ
BLAST of ClCG02G021440 vs. Swiss-Prot
Match: RL18_NEIG1 (50S ribosomal protein L18 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplR PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 9.6e-06 Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 1
BLAST of ClCG02G021440 vs. Swiss-Prot
Match: RL18_NEIMF (50S ribosomal protein L18 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplR PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 9.6e-06 Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 1
BLAST of ClCG02G021440 vs. Swiss-Prot
Match: RL18_NEIMB (50S ribosomal protein L18 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplR PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 9.6e-06 Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 1
BLAST of ClCG02G021440 vs. Swiss-Prot
Match: RL18_NEIM0 (50S ribosomal protein L18 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplR PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 9.6e-06 Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 1
BLAST of ClCG02G021440 vs. Swiss-Prot
Match: RL18_NEIMA (50S ribosomal protein L18 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplR PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 9.6e-06 Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 1
BLAST of ClCG02G021440 vs. TrEMBL
Match: A0A0A0KX15_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G007080 PE=4 SV=1) HSP 1 Score: 231.9 bits (590), Expect = 4.4e-58 Identity = 116/129 (89.92%), Postives = 124/129 (96.12%), Query Frame = 1
BLAST of ClCG02G021440 vs. TrEMBL
Match: V4SBX3_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10002842mg PE=4 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.9e-56 Identity = 114/127 (89.76%), Postives = 121/127 (95.28%), Query Frame = 1
BLAST of ClCG02G021440 vs. TrEMBL
Match: D7SND3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0061g00430 PE=4 SV=1) HSP 1 Score: 224.9 bits (572), Expect = 5.4e-56 Identity = 111/128 (86.72%), Postives = 124/128 (96.88%), Query Frame = 1
BLAST of ClCG02G021440 vs. TrEMBL
Match: A0A0B0NQ41_GOSAR (50S ribosomal L18 OS=Gossypium arboreum GN=F383_06924 PE=4 SV=1) HSP 1 Score: 224.9 bits (572), Expect = 5.4e-56 Identity = 109/127 (85.83%), Postives = 122/127 (96.06%), Query Frame = 1
BLAST of ClCG02G021440 vs. TrEMBL
Match: A0A061H0A9_THECC (Ribosomal L18p/L5e family protein isoform 1 OS=Theobroma cacao GN=TCM_042139 PE=4 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 7.1e-56 Identity = 108/127 (85.04%), Postives = 122/127 (96.06%), Query Frame = 1
BLAST of ClCG02G021440 vs. TAIR10
Match: AT3G45020.1 (AT3G45020.1 Ribosomal L18p/L5e family protein) HSP 1 Score: 208.0 bits (528), Expect = 3.5e-54 Identity = 98/121 (80.99%), Postives = 112/121 (92.56%), Query Frame = 1
BLAST of ClCG02G021440 vs. NCBI nr
Match: gi|659126690|ref|XP_008463315.1| (PREDICTED: 50S ribosomal protein L18, chloroplastic [Cucumis melo]) HSP 1 Score: 235.0 bits (598), Expect = 7.5e-59 Identity = 118/129 (91.47%), Postives = 126/129 (97.67%), Query Frame = 1
BLAST of ClCG02G021440 vs. NCBI nr
Match: gi|778689708|ref|XP_011653002.1| (PREDICTED: uncharacterized protein LOC101206481 [Cucumis sativus]) HSP 1 Score: 231.9 bits (590), Expect = 6.4e-58 Identity = 116/129 (89.92%), Postives = 124/129 (96.12%), Query Frame = 1
BLAST of ClCG02G021440 vs. NCBI nr
Match: gi|700197794|gb|KGN52952.1| (hypothetical protein Csa_4G007080 [Cucumis sativus]) HSP 1 Score: 231.9 bits (590), Expect = 6.4e-58 Identity = 116/129 (89.92%), Postives = 124/129 (96.12%), Query Frame = 1
BLAST of ClCG02G021440 vs. NCBI nr
Match: gi|1009116018|ref|XP_015874550.1| (PREDICTED: uncharacterized protein LOC107411474 [Ziziphus jujuba]) HSP 1 Score: 231.5 bits (589), Expect = 8.3e-58 Identity = 116/127 (91.34%), Postives = 124/127 (97.64%), Query Frame = 1
BLAST of ClCG02G021440 vs. NCBI nr
Match: gi|567878549|ref|XP_006431833.1| (hypothetical protein CICLE_v10002842mg [Citrus clementina]) HSP 1 Score: 226.5 bits (576), Expect = 2.7e-56 Identity = 114/127 (89.76%), Postives = 121/127 (95.28%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |