ClCG02G017860 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAAGGCCAATTCTTGTTGCCACCGGCGCTGGCTTCAGAGACGTCAACTTGGTGAGCTCCGGCGGCCTATTTTTGCTATCTGTCATCTTACTATCTATCTCTCTCATATCAATGGTCATATTTGCCTGCGGCGACTCCGGTGACCCTCAAAAGAAAAGATATAATGGCGGCGGTGGAGGTTGCGGCGGCGGAGGTTGTGGTGGTGGTGGTTGTGGGGGGTGTGGAGGAGGCTGA ATGGGAAGGCCAATTCTTGTTGCCACCGGCGCTGGCTTCAGAGACGTCAACTTGGTGAGCTCCGGCGGCCTATTTTTGCTATCTGTCATCTTACTATCTATCTCTCTCATATCAATGGTCATATTTGCCTGCGGCGACTCCGGTGACCCTCAAAAGAAAAGATATAATGGCGGCGGTGGAGGTTGCGGCGGCGGAGGTTGTGGTGGTGGTGGTTGTGGGGGGTGTGGAGGAGGCTGA ATGGGAAGGCCAATTCTTGTTGCCACCGGCGCTGGCTTCAGAGACGTCAACTTGGTGAGCTCCGGCGGCCTATTTTTGCTATCTGTCATCTTACTATCTATCTCTCTCATATCAATGGTCATATTTGCCTGCGGCGACTCCGGTGACCCTCAAAAGAAAAGATATAATGGCGGCGGTGGAGGTTGCGGCGGCGGAGGTTGTGGTGGTGGTGGTTGTGGGGGGTGTGGAGGAGGCTGA MGRPILVATGAGFRDVNLVSSGGLFLLSVILLSISLISMVIFACGDSGDPQKKRYNGGGGGCGGGGCGGGGCGGCGGG
BLAST of ClCG02G017860 vs. Swiss-Prot
Match: Y5768_DICDI (Putative uncharacterized protein DDB_G0287183 OS=Dictyostelium discoideum GN=DDB_G0287183 PE=5 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 2.6e-06 Identity = 24/54 (44.44%), Postives = 28/54 (51.85%), Query Frame = 1
HSP 2 Score: 41.6 bits (96), Expect = 4.7e-03 Identity = 17/20 (85.00%), Postives = 15/20 (75.00%), Query Frame = 1
HSP 3 Score: 35.4 bits (80), Expect = 3.3e-01 Identity = 17/23 (73.91%), Postives = 15/23 (65.22%), Query Frame = 1
BLAST of ClCG02G017860 vs. TrEMBL
Match: A0A0L9TEF9_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan618s000900 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.2e-11 Identity = 39/81 (48.15%), Postives = 51/81 (62.96%), Query Frame = 1
BLAST of ClCG02G017860 vs. TrEMBL
Match: A0A0L9TEF9_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan618s000900 PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-10 Identity = 41/93 (44.09%), Postives = 53/93 (56.99%), Query Frame = 1
HSP 2 Score: 49.3 bits (116), Expect = 2.5e-03 Identity = 23/35 (65.71%), Postives = 23/35 (65.71%), Query Frame = 1
HSP 3 Score: 47.0 bits (110), Expect = 1.2e-02 Identity = 24/40 (60.00%), Postives = 24/40 (60.00%), Query Frame = 1
BLAST of ClCG02G017860 vs. TAIR10
Match: AT3G14480.1 (AT3G14480.1 glycine/proline-rich protein) HSP 1 Score: 48.1 bits (113), Expect = 2.8e-06 Identity = 27/67 (40.30%), Postives = 31/67 (46.27%), Query Frame = 1
BLAST of ClCG02G017860 vs. NCBI nr
Match: gi|567908975|ref|XP_006446801.1| (hypothetical protein CICLE_v10017260mg [Citrus clementina]) HSP 1 Score: 87.4 bits (215), Expect = 1.2e-14 Identity = 47/95 (49.47%), Postives = 56/95 (58.95%), Query Frame = 1
BLAST of ClCG02G017860 vs. NCBI nr
Match: gi|567908975|ref|XP_006446801.1| (hypothetical protein CICLE_v10017260mg [Citrus clementina]) HSP 1 Score: 52.0 bits (123), Expect = 5.5e-04 Identity = 21/22 (95.45%), Postives = 21/22 (95.45%), Query Frame = 1
HSP 2 Score: 48.5 bits (114), Expect = 6.1e-03 Identity = 21/29 (72.41%), Postives = 21/29 (72.41%), Query Frame = 1
HSP 3 Score: 46.6 bits (109), Expect = 2.3e-02 Identity = 21/33 (63.64%), Postives = 21/33 (63.64%), Query Frame = 1
HSP 4 Score: 42.4 bits (98), Expect = 4.4e-01 Identity = 21/34 (61.76%), Postives = 21/34 (61.76%), Query Frame = 1
HSP 5 Score: 87.0 bits (214), Expect = 1.5e-14 Identity = 43/82 (52.44%), Postives = 54/82 (65.85%), Query Frame = 1
BLAST of ClCG02G017860 vs. NCBI nr
Match: gi|985434705|ref|XP_015382723.1| (PREDICTED: loricrin-like [Citrus sinensis]) HSP 1 Score: 72.8 bits (177), Expect = 3.0e-10 Identity = 44/99 (44.44%), Postives = 55/99 (55.56%), Query Frame = 1
HSP 2 Score: 46.6 bits (109), Expect = 2.3e-02 Identity = 22/36 (61.11%), Postives = 22/36 (61.11%), Query Frame = 1
HSP 3 Score: 42.0 bits (97), Expect = 5.7e-01 Identity = 19/33 (57.58%), Postives = 19/33 (57.58%), Query Frame = 1
HSP 4 Score: 80.1 bits (196), Expect = 1.9e-12 Identity = 45/75 (60.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of ClCG02G017860 vs. NCBI nr
Match: gi|566171168|ref|XP_006383269.1| (hypothetical protein POPTR_0005s13010g [Populus trichocarpa]) HSP 1 Score: 70.1 bits (170), Expect = 2.0e-09 Identity = 46/90 (51.11%), Postives = 55/90 (61.11%), Query Frame = 1
HSP 2 Score: 77.4 bits (189), Expect = 1.2e-11 Identity = 38/75 (50.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of ClCG02G017860 vs. NCBI nr
Match: gi|697095740|ref|XP_009612867.1| (PREDICTED: acanthoscurrin-1-like [Nicotiana tomentosiformis]) HSP 1 Score: 76.6 bits (187), Expect = 2.1e-11 Identity = 39/85 (45.88%), Postives = 51/85 (60.00%), Query Frame = 1
HSP 2 Score: 71.2 bits (173), Expect = 8.8e-10 Identity = 41/95 (43.16%), Postives = 53/95 (55.79%), Query Frame = 1
HSP 3 Score: 40.8 bits (94), Expect = 1.3e+00 Identity = 20/34 (58.82%), Postives = 20/34 (58.82%), Query Frame = 1
HSP 4 Score: 75.1 bits (183), Expect = 6.1e-11 Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |