Carg27204 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCACAGGAGACGGCGAAAAGCAACAATATCCGGCGCATTGTTCGGCTCCGTCAAATGCTACAACACTGGCGCCAGACGGCACGAGTGGCATCCTCCAGAGCACCGCCGTCCGACGTCCCTGCGGGTCACATCGCCGTCTGTGTCGGCAGCGAATATCGGCGATTCATCGTCCGCGCTACCTTCTTGAACCATCCGATCTTCCAGAAGCTTCTCACGGAAGCTGAAGAAGAATACGGCTTCACTACGCAAGGTGCTCTGGCGCTTCCGTGCGACGAATCGGTATTCGAAGAGGTTCTCCGAGTCGTCGCTCGTTCCGAGTTGCGTAACTCATCGCGAAATCCGAATCTCACAGATTGGCAGAGGCGATGCGATGAAGATGTCAGAAAGAACTCCGAGTTTTTAGGCGAATCAAGACCTTTACTGTATGGATTTGCCGATAGTAAATCCGTTTGTTGA ATGTCACAGGAGACGGCGAAAAGCAACAATATCCGGCGCATTGTTCGGCTCCGTCAAATGCTACAACACTGGCGCCAGACGGCACGAGTGGCATCCTCCAGAGCACCGCCGTCCGACGTCCCTGCGGGTCACATCGCCGTCTGTGTCGGCAGCGAATATCGGCGATTCATCGTCCGCGCTACCTTCTTGAACCATCCGATCTTCCAGAAGCTTCTCACGGAAGCTGAAGAAGAATACGGCTTCACTACGCAAGGTGCTCTGGCGCTTCCGTGCGACGAATCGGTATTCGAAGAGGTTCTCCGAGTCGTCGCTCGTTCCGAGTTGCGTAACTCATCGCGAAATCCGAATCTCACAGATTGGCAGAGGCGATGCGATGAAGATGTCAGAAAGAACTCCGAGTTTTTAGGCGAATCAAGACCTTTACTGTATGGATTTGCCGATAGTAAATCCGTTTGTTGA ATGTCACAGGAGACGGCGAAAAGCAACAATATCCGGCGCATTGTTCGGCTCCGTCAAATGCTACAACACTGGCGCCAGACGGCACGAGTGGCATCCTCCAGAGCACCGCCGTCCGACGTCCCTGCGGGTCACATCGCCGTCTGTGTCGGCAGCGAATATCGGCGATTCATCGTCCGCGCTACCTTCTTGAACCATCCGATCTTCCAGAAGCTTCTCACGGAAGCTGAAGAAGAATACGGCTTCACTACGCAAGGTGCTCTGGCGCTTCCGTGCGACGAATCGGTATTCGAAGAGGTTCTCCGAGTCGTCGCTCGTTCCGAGTTGCGTAACTCATCGCGAAATCCGAATCTCACAGATTGGCAGAGGCGATGCGATGAAGATGTCAGAAAGAACTCCGAGTTTTTAGGCGAATCAAGACCTTTACTGTATGGATTTGCCGATAGTAAATCCGTTTGTTGA MSQETAKSNNIRRIVRLRQMLQHWRQTARVASSRAPPSDVPAGHIAVCVGSEYRRFIVRATFLNHPIFQKLLTEAEEEYGFTTQGALALPCDESVFEEVLRVVARSELRNSSRNPNLTDWQRRCDEDVRKNSEFLGESRPLLYGFADSKSVC
BLAST of Carg27204 vs. NCBI nr
Match: XP_022947562.1 (auxin-responsive protein SAUR71-like [Cucurbita moschata]) HSP 1 Score: 304.7 bits (779), Expect = 1.8e-79 Identity = 150/152 (98.68%), Postives = 151/152 (99.34%), Query Frame = 0
BLAST of Carg27204 vs. NCBI nr
Match: XP_023534044.1 (auxin-responsive protein SAUR71-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 303.1 bits (775), Expect = 5.2e-79 Identity = 147/152 (96.71%), Postives = 151/152 (99.34%), Query Frame = 0
BLAST of Carg27204 vs. NCBI nr
Match: XP_023006979.1 (auxin-responsive protein SAUR71-like [Cucurbita maxima]) HSP 1 Score: 290.8 bits (743), Expect = 2.7e-75 Identity = 143/152 (94.08%), Postives = 147/152 (96.71%), Query Frame = 0
BLAST of Carg27204 vs. NCBI nr
Match: XP_008457620.1 (PREDICTED: auxin-responsive protein SAUR64 [Cucumis melo]) HSP 1 Score: 241.9 bits (616), Expect = 1.4e-60 Identity = 122/153 (79.74%), Postives = 135/153 (88.24%), Query Frame = 0
BLAST of Carg27204 vs. NCBI nr
Match: XP_004147056.1 (PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]) HSP 1 Score: 240.7 bits (613), Expect = 3.2e-60 Identity = 122/153 (79.74%), Postives = 132/153 (86.27%), Query Frame = 0
BLAST of Carg27204 vs. TAIR10
Match: AT1G19840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 152.9 bits (385), Expect = 1.6e-37 Identity = 80/150 (53.33%), Postives = 106/150 (70.67%), Query Frame = 0
BLAST of Carg27204 vs. TAIR10
Match: AT1G75590.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 149.4 bits (376), Expect = 1.7e-36 Identity = 77/150 (51.33%), Postives = 102/150 (68.00%), Query Frame = 0
BLAST of Carg27204 vs. TAIR10
Match: AT4G34750.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 140.6 bits (353), Expect = 8.1e-34 Identity = 78/152 (51.32%), Postives = 101/152 (66.45%), Query Frame = 0
BLAST of Carg27204 vs. TAIR10
Match: AT5G10990.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 137.5 bits (345), Expect = 6.8e-33 Identity = 73/148 (49.32%), Postives = 97/148 (65.54%), Query Frame = 0
BLAST of Carg27204 vs. TAIR10
Match: AT3G43120.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 82.8 bits (203), Expect = 2.0e-16 Identity = 49/137 (35.77%), Postives = 68/137 (49.64%), Query Frame = 0
BLAST of Carg27204 vs. Swiss-Prot
Match: sp|O64538|SAU40_ARATH (Auxin-responsive protein SAUR40 OS=Arabidopsis thaliana OX=3702 GN=SAUR40 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.9e-12 Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of Carg27204 vs. Swiss-Prot
Match: sp|Q9SA49|SAU41_ARATH (Auxin-responsive protein SAUR41 OS=Arabidopsis thaliana OX=3702 GN=SAUR41 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 6.4e-12 Identity = 37/94 (39.36%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of Carg27204 vs. Swiss-Prot
Match: sp|O65695|SAU50_ARATH (Auxin-responsive protein SAUR50 OS=Arabidopsis thaliana OX=3702 GN=SAUR50 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 6.4e-12 Identity = 33/67 (49.25%), Postives = 41/67 (61.19%), Query Frame = 0
BLAST of Carg27204 vs. Swiss-Prot
Match: sp|Q9LTV3|SAU72_ARATH (Auxin-responsive protein SAUR72 OS=Arabidopsis thaliana OX=3702 GN=SAUR72 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 8.3e-12 Identity = 31/68 (45.59%), Postives = 42/68 (61.76%), Query Frame = 0
BLAST of Carg27204 vs. Swiss-Prot
Match: sp|Q9SGU2|SAU71_ARATH (Auxin-responsive protein SAUR71 OS=Arabidopsis thaliana OX=3702 GN=SAUR71 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.1e-11 Identity = 38/94 (40.43%), Postives = 51/94 (54.26%), Query Frame = 0
BLAST of Carg27204 vs. TrEMBL
Match: tr|A0A1S3C5H3|A0A1S3C5H3_CUCME (auxin-responsive protein SAUR64 OS=Cucumis melo OX=3656 GN=LOC103497270 PE=4 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 9.4e-61 Identity = 122/153 (79.74%), Postives = 135/153 (88.24%), Query Frame = 0
BLAST of Carg27204 vs. TrEMBL
Match: tr|A0A0A0LM48|A0A0A0LM48_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G257100 PE=4 SV=1) HSP 1 Score: 240.7 bits (613), Expect = 2.1e-60 Identity = 122/153 (79.74%), Postives = 132/153 (86.27%), Query Frame = 0
BLAST of Carg27204 vs. TrEMBL
Match: tr|M5VP66|M5VP66_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_8G082200 PE=4 SV=1) HSP 1 Score: 204.9 bits (520), Expect = 1.3e-49 Identity = 106/152 (69.74%), Postives = 120/152 (78.95%), Query Frame = 0
BLAST of Carg27204 vs. TrEMBL
Match: tr|A0A2I4E7C7|A0A2I4E7C7_9ROSI (indole-3-acetic acid-induced protein ARG7-like OS=Juglans regia OX=51240 GN=LOC108986945 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 5.0e-46 Identity = 99/152 (65.13%), Postives = 122/152 (80.26%), Query Frame = 0
BLAST of Carg27204 vs. TrEMBL
Match: tr|A0A1U7Z2R9|A0A1U7Z2R9_NELNU (indole-3-acetic acid-induced protein ARG7-like OS=Nelumbo nucifera OX=4432 GN=LOC104589704 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 1.9e-45 Identity = 93/151 (61.59%), Postives = 115/151 (76.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|