Carg18201 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTCAAGAAACATGCAAGAAATGTGCAGCCACCACTCCAAACCTCAGCTACGCCTTCTGTGTTTCGTCTTTAGAATCCGATGATCGGAGCCGCTCGGCAAGTCTCCACAGACTTGGGCTCATCTCCATGGATCTACTGCGCCACAACTTAACCAGCACACGACGTGAAGTCAAGAAGCTTTTGAGGAACAAGACATTGGATGGGTTCGTTAAGGCGCGTTTAGATGATTGTTTGGAGCTTTATTCTGATGCGATTCCGACGCTGAAAGAATGTAAAAGGGAGTATAAACAGAAGCGTTTTAGTGATGCAAATGTGAAGGTTAGTTCAATCATGGAAGCTCCTTCAACTTGCGAAGATGGGTTTCATGAAAAACAAGGCGTGGTTTCACCGTTGACTAAGAATAATAAGAATGTTTTTCAGTTAGCTGCGTTGACTCTCTCCATCGTCAACATGAATATGCATCTTCAATGA ATGGTTCAAGAAACATGCAAGAAATGTGCAGCCACCACTCCAAACCTCAGCTACGCCTTCTGTGTTTCGTCTTTAGAATCCGATGATCGGAGCCGCTCGGCAAGTCTCCACAGACTTGGGCTCATCTCCATGGATCTACTGCGCCACAACTTAACCAGCACACGACGTGAAGTCAAGAAGCTTTTGAGGAACAAGACATTGGATGGGTTCGTTAAGGCGCGTTTAGATGATTGTTTGGAGCTTTATTCTGATGCGATTCCGACGCTGAAAGAATGTAAAAGGGAGTATAAACAGAAGCGTTTTAGTGATGCAAATGTGAAGGTTAGTTCAATCATGGAAGCTCCTTCAACTTGCGAAGATGGGTTTCATGAAAAACAAGGCGTGGTTTCACCGTTGACTAAGAATAATAAGAATGTTTTTCAGTTAGCTGCGTTGACTCTCTCCATCGTCAACATGAATATGCATCTTCAATGA ATGGTTCAAGAAACATGCAAGAAATGTGCAGCCACCACTCCAAACCTCAGCTACGCCTTCTGTGTTTCGTCTTTAGAATCCGATGATCGGAGCCGCTCGGCAAGTCTCCACAGACTTGGGCTCATCTCCATGGATCTACTGCGCCACAACTTAACCAGCACACGACGTGAAGTCAAGAAGCTTTTGAGGAACAAGACATTGGATGGGTTCGTTAAGGCGCGTTTAGATGATTGTTTGGAGCTTTATTCTGATGCGATTCCGACGCTGAAAGAATGTAAAAGGGAGTATAAACAGAAGCGTTTTAGTGATGCAAATGTGAAGGTTAGTTCAATCATGGAAGCTCCTTCAACTTGCGAAGATGGGTTTCATGAAAAACAAGGCGTGGTTTCACCGTTGACTAAGAATAATAAGAATGTTTTTCAGTTAGCTGCGTTGACTCTCTCCATCGTCAACATGAATATGCATCTTCAATGA MVQETCKKCAATTPNLSYAFCVSSLESDDRSRSASLHRLGLISMDLLRHNLTSTRREVKKLLRNKTLDGFVKARLDDCLELYSDAIPTLKECKREYKQKRFSDANVKVSSIMEAPSTCEDGFHEKQGVVSPLTKNNKNVFQLAALTLSIVNMNMHLQ
BLAST of Carg18201 vs. NCBI nr
Match: XP_023531537.1 (putative invertase inhibitor [Cucurbita pepo subsp. pepo]) HSP 1 Score: 306.2 bits (783), Expect = 6.3e-80 Identity = 155/157 (98.73%), Postives = 157/157 (100.00%), Query Frame = 0
BLAST of Carg18201 vs. NCBI nr
Match: XP_022933437.1 (putative invertase inhibitor [Cucurbita moschata]) HSP 1 Score: 302.8 bits (774), Expect = 7.0e-79 Identity = 155/157 (98.73%), Postives = 155/157 (98.73%), Query Frame = 0
BLAST of Carg18201 vs. NCBI nr
Match: XP_022973011.1 (putative invertase inhibitor [Cucurbita maxima]) HSP 1 Score: 300.1 bits (767), Expect = 4.5e-78 Identity = 152/157 (96.82%), Postives = 155/157 (98.73%), Query Frame = 0
BLAST of Carg18201 vs. NCBI nr
Match: XP_022135283.1 (putative invertase inhibitor [Momordica charantia]) HSP 1 Score: 248.4 bits (633), Expect = 1.6e-62 Identity = 120/157 (76.43%), Postives = 143/157 (91.08%), Query Frame = 0
BLAST of Carg18201 vs. NCBI nr
Match: KGN63686.1 (hypothetical protein Csa_1G009900 [Cucumis sativus]) HSP 1 Score: 242.3 bits (617), Expect = 1.1e-60 Identity = 115/155 (74.19%), Postives = 140/155 (90.32%), Query Frame = 0
BLAST of Carg18201 vs. TAIR10
Match: AT5G46970.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 96.7 bits (239), Expect = 1.4e-20 Identity = 58/142 (40.85%), Postives = 84/142 (59.15%), Query Frame = 0
BLAST of Carg18201 vs. TAIR10
Match: AT5G46940.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 95.1 bits (235), Expect = 4.0e-20 Identity = 52/153 (33.99%), Postives = 88/153 (57.52%), Query Frame = 0
BLAST of Carg18201 vs. TAIR10
Match: AT5G38610.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 85.9 bits (211), Expect = 2.4e-17 Identity = 58/165 (35.15%), Postives = 81/165 (49.09%), Query Frame = 0
BLAST of Carg18201 vs. TAIR10
Match: AT5G46930.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 83.6 bits (205), Expect = 1.2e-16 Identity = 52/154 (33.77%), Postives = 85/154 (55.19%), Query Frame = 0
BLAST of Carg18201 vs. TAIR10
Match: AT1G54620.1 (Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 71.6 bits (174), Expect = 4.8e-13 Identity = 48/157 (30.57%), Postives = 77/157 (49.04%), Query Frame = 0
BLAST of Carg18201 vs. Swiss-Prot
Match: sp|Q8GT41|PLA1_PLAAC (Putative invertase inhibitor OS=Platanus acerifolia OX=140101 PE=1 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.5e-27 Identity = 64/152 (42.11%), Postives = 105/152 (69.08%), Query Frame = 0
BLAST of Carg18201 vs. Swiss-Prot
Match: sp|O49603|CVIF2_ARATH (Cell wall / vacuolar inhibitor of fructosidase 2 OS=Arabidopsis thaliana OX=3702 GN=C/VIF2 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 4.9e-07 Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 0
BLAST of Carg18201 vs. Swiss-Prot
Match: sp|Q9LUV1|PMEI2_ARATH (Pectinesterase inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=PMEI2 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.9e-06 Identity = 38/135 (28.15%), Postives = 66/135 (48.89%), Query Frame = 0
BLAST of Carg18201 vs. TrEMBL
Match: tr|A0A0A0LUJ3|A0A0A0LUJ3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G009900 PE=4 SV=1) HSP 1 Score: 242.3 bits (617), Expect = 7.4e-61 Identity = 115/155 (74.19%), Postives = 140/155 (90.32%), Query Frame = 0
BLAST of Carg18201 vs. TrEMBL
Match: tr|A0A2P6SEF8|A0A2P6SEF8_ROSCH (Putative pectinesterase inhibitor domain-containing protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0344051 PE=4 SV=1) HSP 1 Score: 193.4 bits (490), Expect = 4.0e-46 Identity = 93/152 (61.18%), Postives = 119/152 (78.29%), Query Frame = 0
BLAST of Carg18201 vs. TrEMBL
Match: tr|A0A2K1XQD5|A0A2K1XQD5_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_014G044100v3 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 4.8e-44 Identity = 85/152 (55.92%), Postives = 123/152 (80.92%), Query Frame = 0
BLAST of Carg18201 vs. TrEMBL
Match: tr|A0A2P4LWE7|A0A2P4LWE7_QUESU (Putative invertase inhibitor OS=Quercus suber OX=58331 GN=CFP56_73246 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.0e-42 Identity = 86/153 (56.21%), Postives = 117/153 (76.47%), Query Frame = 0
BLAST of Carg18201 vs. TrEMBL
Match: tr|M5X7H8|M5X7H8_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G115600 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 4.5e-42 Identity = 83/152 (54.61%), Postives = 120/152 (78.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |