Carg16467 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGTCGTTACCGATATGTTTAGCTTTAATTACGATGCTGATGACAAGCCAACAAGTGATGACGAACCAAGAAGCAACATCACAAATAAAATATCTTAAACATTTAGAATGTCATCATCCTAACCCACCTGCACATTGTTCTTTATCTGGAGTTAAGGGCTATCAACATGTTCCTGCTAATCCCTATGATCGAGGATGCTCTGCTATCCATCGATGTCGAGGAGGAAGTTAATCAATATTTGAAATTATTGTTTTCTTCTATAGGAAGGAAAAATGAGTAA ATGAAGTCGTTACCGATATGTTTAGCTTTAATTACGATGCTGATGACAAGCCAACAAGTGATGACGAACCAAGAAGCAACATCACAAATAAAATATCTTAAACATTTAGAATGTCATCATCCTAACCCACCTGCACATTGTTCTTTATCTGGAGTTAAGGGCTATCAACATGTTCCTGCTAATCCCTATGATCGAGGATGCTCTGCTATCCATCGATGTCGAGGAGGAAGAAGGAAAAATGAGTAA ATGAAGTCGTTACCGATATGTTTAGCTTTAATTACGATGCTGATGACAAGCCAACAAGTGATGACGAACCAAGAAGCAACATCACAAATAAAATATCTTAAACATTTAGAATGTCATCATCCTAACCCACCTGCACATTGTTCTTTATCTGGAGTTAAGGGCTATCAACATGTTCCTGCTAATCCCTATGATCGAGGATGCTCTGCTATCCATCGATGTCGAGGAGGAAGAAGGAAAAATGAGTAA MKSLPICLALITMLMTSQQVMTNQEATSQIKYLKHLECHHPNPPAHCSLSGVKGYQHVPANPYDRGCSAIHRCRGGRRKNE
BLAST of Carg16467 vs. NCBI nr
Match: XP_023533089.1 (protein RALF-like 10 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 38/77 (49.35%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Carg16467 vs. NCBI nr
Match: XP_022947821.1 (protein RALF-like 10 [Cucurbita moschata]) HSP 1 Score: 63.5 bits (153), Expect = 3.7e-07 Identity = 39/77 (50.65%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of Carg16467 vs. NCBI nr
Match: KGN66777.1 (hypothetical protein Csa_1G690160 [Cucumis sativus]) HSP 1 Score: 63.2 bits (152), Expect = 4.8e-07 Identity = 39/75 (52.00%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of Carg16467 vs. NCBI nr
Match: KGN61625.1 (hypothetical protein Csa_2G191310 [Cucumis sativus]) HSP 1 Score: 54.7 bits (130), Expect = 1.7e-04 Identity = 35/77 (45.45%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Carg16467 vs. NCBI nr
Match: OAP10003.1 (RALFL12 [Arabidopsis thaliana]) HSP 1 Score: 53.5 bits (127), Expect = 3.8e-04 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of Carg16467 vs. TAIR10
Match: AT2G19030.1 (ralf-like 11) HSP 1 Score: 51.2 bits (121), Expect = 3.4e-07 Identity = 29/74 (39.19%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Carg16467 vs. TAIR10
Match: AT2G19045.1 (RALF-like 13) HSP 1 Score: 50.4 bits (119), Expect = 5.9e-07 Identity = 29/74 (39.19%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Carg16467 vs. TAIR10
Match: AT2G19040.1 (RALF-like 12) HSP 1 Score: 47.8 bits (112), Expect = 3.8e-06 Identity = 28/74 (37.84%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Carg16467 vs. TAIR10
Match: AT2G19020.1 (ralf-like 10) HSP 1 Score: 43.9 bits (102), Expect = 5.5e-05 Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of Carg16467 vs. Swiss-Prot
Match: sp|O64466|RLF11_ARATH (Protein RALF-like 11 OS=Arabidopsis thaliana OX=3702 GN=RALFL11 PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 6.2e-06 Identity = 29/74 (39.19%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Carg16467 vs. Swiss-Prot
Match: sp|F4ISE2|RLF13_ARATH (Protein RALF-like 13 OS=Arabidopsis thaliana OX=3702 GN=RALFL13 PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 29/74 (39.19%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Carg16467 vs. Swiss-Prot
Match: sp|F4ISE1|RLF12_ARATH (Protein RALF-like 12 OS=Arabidopsis thaliana OX=3702 GN=RALFL12 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 6.9e-05 Identity = 28/74 (37.84%), Postives = 40/74 (54.05%), Query Frame = 0
BLAST of Carg16467 vs. Swiss-Prot
Match: sp|O65919|RLF10_ARATH (Protein RALF-like 10 OS=Arabidopsis thaliana OX=3702 GN=RALFL10 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 9.9e-04 Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of Carg16467 vs. TrEMBL
Match: tr|A0A0A0M0X3|A0A0A0M0X3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G690160 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 3.2e-07 Identity = 39/75 (52.00%), Postives = 47/75 (62.67%), Query Frame = 0
BLAST of Carg16467 vs. TrEMBL
Match: tr|A0A0A0LI94|A0A0A0LI94_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G191310 PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 1.1e-04 Identity = 35/77 (45.45%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Carg16467 vs. TrEMBL
Match: tr|A0A178VY78|A0A178VY78_ARATH (RALFL12 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At2g14390 PE=4 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.5e-04 Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of Carg16467 vs. TrEMBL
Match: tr|M4DF40|M4DF40_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis OX=51351 PE=4 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 7.3e-04 Identity = 35/71 (49.30%), Postives = 39/71 (54.93%), Query Frame = 0
BLAST of Carg16467 vs. TrEMBL
Match: tr|B2Y4P5|B2Y4P5_ARAHH (Putative rapid alkalinization factor (RALF) family protein OS=Arabidopsis halleri subsp. halleri OX=81971 GN=7C17.2 PE=4 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 7.3e-04 Identity = 29/74 (39.19%), Postives = 40/74 (54.05%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|