Carg12382 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGAGAATTGGAATCTATCAAAGAAGGAAGGTTCAGGAAGTAGTTACCAGTCTTCTACGAATCCCAAGTCGTCGTTCACAAGGAGTGGTTCCACCACCAAATCGCCATTACTGCGATGTTCTTCACAGAGAACTTTCCCAGCTTCCACTTCCAAGACCCCCAACGATCTCCCTCGAAGTTACTCGCAGAAGAGCTCTTCTTCAGCAGGACGTAAATACAGCAGCTTAGCTAAGGAACAGAAGGCCCGATTCTACATCATGAGACGCTGCGTGGCGATGCTCGTTTGTTGGCACAAGCATGGCGATTCGTAA ATGGACGAGAATTGGAATCTATCAAAGAAGGAAGGTTCAGGAAGTAGTTACCAGTCTTCTACGAATCCCAAGTCGTCGTTCACAAGGAGTGGTTCCACCACCAAATCGCCATTACTGCGATGTTCTTCACAGAGAACTTTCCCAGCTTCCACTTCCAAGACCCCCAACGATCTCCCTCGAAGTTACTCGCAGAAGAGCTCTTCTTCAGCAGGACGTAAATACAGCAGCTTAGCTAAGGAACAGAAGGCCCGATTCTACATCATGAGACGCTGCGTGGCGATGCTCGTTTGTTGGCACAAGCATGGCGATTCGTAA ATGGACGAGAATTGGAATCTATCAAAGAAGGAAGGTTCAGGAAGTAGTTACCAGTCTTCTACGAATCCCAAGTCGTCGTTCACAAGGAGTGGTTCCACCACCAAATCGCCATTACTGCGATGTTCTTCACAGAGAACTTTCCCAGCTTCCACTTCCAAGACCCCCAACGATCTCCCTCGAAGTTACTCGCAGAAGAGCTCTTCTTCAGCAGGACGTAAATACAGCAGCTTAGCTAAGGAACAGAAGGCCCGATTCTACATCATGAGACGCTGCGTGGCGATGCTCGTTTGTTGGCACAAGCATGGCGATTCGTAA MDENWNLSKKEGSGSSYQSSTNPKSSFTRSGSTTKSPLLRCSSQRTFPASTSKTPNDLPRSYSQKSSSSAGRKYSSLAKEQKARFYIMRRCVAMLVCWHKHGDS
BLAST of Carg12382 vs. NCBI nr
Match: XP_022948433.1 (uncharacterized protein LOC111452118 [Cucurbita moschata] >XP_022997686.1 uncharacterized protein LOC111492575 [Cucurbita maxima] >XP_023523193.1 uncharacterized protein LOC111787458 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 200.3 bits (508), Expect = 3.2e-48 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of Carg12382 vs. NCBI nr
Match: XP_022964705.1 (uncharacterized protein LOC111464706 [Cucurbita moschata] >XP_023521043.1 uncharacterized protein LOC111784640 [Cucurbita pepo subsp. pepo] >XP_023519187.1 uncharacterized protein LOC111782636 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 162.5 bits (410), Expect = 7.5e-37 Identity = 87/104 (83.65%), Postives = 93/104 (89.42%), Query Frame = 0
BLAST of Carg12382 vs. NCBI nr
Match: XP_022155122.1 (uncharacterized protein LOC111022262 [Momordica charantia]) HSP 1 Score: 115.5 bits (288), Expect = 1.1e-22 Identity = 68/104 (65.38%), Postives = 71/104 (68.27%), Query Frame = 0
BLAST of Carg12382 vs. NCBI nr
Match: XP_004153482.1 (PREDICTED: uncharacterized protein LOC101207628 [Cucumis sativus] >KGN65741.1 hypothetical protein Csa_1G524140 [Cucumis sativus]) HSP 1 Score: 85.5 bits (210), Expect = 1.2e-13 Identity = 59/106 (55.66%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Carg12382 vs. NCBI nr
Match: XP_008457457.1 (PREDICTED: uncharacterized protein LOC103497141 [Cucumis melo] >XP_016902125.1 PREDICTED: uncharacterized protein LOC103497141 [Cucumis melo]) HSP 1 Score: 84.3 bits (207), Expect = 2.6e-13 Identity = 58/106 (54.72%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Carg12382 vs. TAIR10
Match: AT2G29125.1 (ROTUNDIFOLIA like 2) HSP 1 Score: 72.4 bits (176), Expect = 1.8e-13 Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of Carg12382 vs. TAIR10
Match: AT1G07490.1 (ROTUNDIFOLIA like 3) HSP 1 Score: 63.9 bits (154), Expect = 6.6e-11 Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of Carg12382 vs. TAIR10
Match: AT5G59510.1 (ROTUNDIFOLIA like 5) HSP 1 Score: 59.3 bits (142), Expect = 1.6e-09 Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of Carg12382 vs. TAIR10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7) HSP 1 Score: 50.8 bits (120), Expect = 5.8e-07 Identity = 21/33 (63.64%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of Carg12382 vs. TAIR10
Match: AT2G36985.1 (DVL family protein) HSP 1 Score: 49.3 bits (116), Expect = 1.7e-06 Identity = 19/29 (65.52%), Postives = 26/29 (89.66%), Query Frame = 0
BLAST of Carg12382 vs. TrEMBL
Match: tr|A0A0A0M0J4|A0A0A0M0J4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G524140 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 7.7e-14 Identity = 59/106 (55.66%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Carg12382 vs. TrEMBL
Match: tr|A0A1S3C552|A0A1S3C552_CUCME (uncharacterized protein LOC103497141 OS=Cucumis melo OX=3656 GN=LOC103497141 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.7e-13 Identity = 58/106 (54.72%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Carg12382 vs. TrEMBL
Match: tr|A0A2H5NCY6|A0A2H5NCY6_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_033790 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.7e-13 Identity = 58/108 (53.70%), Postives = 64/108 (59.26%), Query Frame = 0
BLAST of Carg12382 vs. TrEMBL
Match: tr|V4SM00|V4SM00_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10030229mg PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 2.9e-13 Identity = 58/108 (53.70%), Postives = 64/108 (59.26%), Query Frame = 0
BLAST of Carg12382 vs. TrEMBL
Match: tr|A0A067L1G2|A0A067L1G2_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_02962 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 6.5e-13 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |