Carg00038 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTCGCAAAACCAAAATGTACCATCAGAGGCCCAAGATATCAAGACAGCAATTAAGGGTAATCTTCAGAAACCACGACCGAGATGGTGACGGCCGCCTGAGCTCCGCCGAGCTGACCAAAGCCTTCCACTACATCGGTGCCCTTCTGCCATCATTCAGAGCTTGCCACGCTCTTCTTTACACCGATTCTGACAGAGACGGATTCATCGATGAGAAGGATTTCGAACAGCTCATTGATTATGCCGAGAAACGCCAATACACCGTCATTTAA ATGCCTCGCAAAACCAAAATGTACCATCAGAGGCCCAAGATATCAAGACAGCAATTAAGGGTAATCTTCAGAAACCACGACCGAGATGGTGACGGCCGCCTGAGCTCCGCCGAGCTGACCAAAGCCTTCCACTACATCGGTGCCCTTCTGCCATCATTCAGAGCTTGCCACGCTCTTCTTTACACCGATTCTGACAGAGACGGATTCATCGATGAGAAGGATTTCGAACAGCTCATTGATTATGCCGAGAAACGCCAATACACCGTCATTTAA ATGCCTCGCAAAACCAAAATGTACCATCAGAGGCCCAAGATATCAAGACAGCAATTAAGGGTAATCTTCAGAAACCACGACCGAGATGGTGACGGCCGCCTGAGCTCCGCCGAGCTGACCAAAGCCTTCCACTACATCGGTGCCCTTCTGCCATCATTCAGAGCTTGCCACGCTCTTCTTTACACCGATTCTGACAGAGACGGATTCATCGATGAGAAGGATTTCGAACAGCTCATTGATTATGCCGAGAAACGCCAATACACCGTCATTTAA MPRKTKMYHQRPKISRQQLRVIFRNHDRDGDGRLSSAELTKAFHYIGALLPSFRACHALLYTDSDRDGFIDEKDFEQLIDYAEKRQYTVI
BLAST of Carg00038 vs. NCBI nr
Match: KGN55185.1 (hypothetical protein Csa_4G639730 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 2.1e-27 Identity = 62/90 (68.89%), Postives = 76/90 (84.44%), Query Frame = 0
BLAST of Carg00038 vs. NCBI nr
Match: POF10332.1 (calcium-binding allergen ole e 8 [Quercus suber]) HSP 1 Score: 84.0 bits (206), Expect = 2.9e-13 Identity = 42/91 (46.15%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of Carg00038 vs. NCBI nr
Match: XP_022951880.1 (calmodulin-like [Cucurbita moschata]) HSP 1 Score: 82.4 bits (202), Expect = 8.5e-13 Identity = 37/72 (51.39%), Postives = 55/72 (76.39%), Query Frame = 0
BLAST of Carg00038 vs. NCBI nr
Match: XP_004152805.1 (PREDICTED: probable calcium-binding protein CML10 [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 1.9e-12 Identity = 35/77 (45.45%), Postives = 57/77 (74.03%), Query Frame = 0
BLAST of Carg00038 vs. NCBI nr
Match: KGN62516.1 (hypothetical protein Csa_2G358870 [Cucumis sativus]) HSP 1 Score: 81.3 bits (199), Expect = 1.9e-12 Identity = 35/77 (45.45%), Postives = 57/77 (74.03%), Query Frame = 0
BLAST of Carg00038 vs. TAIR10
Match: AT1G76650.1 (calmodulin-like 38) HSP 1 Score: 47.8 bits (112), Expect = 4.2e-06 Identity = 24/70 (34.29%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of Carg00038 vs. TAIR10
Match: AT3G50770.1 (calmodulin-like 41) HSP 1 Score: 45.8 bits (107), Expect = 1.6e-05 Identity = 23/65 (35.38%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Carg00038 vs. TAIR10
Match: AT2G43290.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 42.4 bits (98), Expect = 1.8e-04 Identity = 19/66 (28.79%), Postives = 36/66 (54.55%), Query Frame = 0
BLAST of Carg00038 vs. TAIR10
Match: AT3G51920.1 (calmodulin 9) HSP 1 Score: 42.0 bits (97), Expect = 2.3e-04 Identity = 21/62 (33.87%), Postives = 34/62 (54.84%), Query Frame = 0
BLAST of Carg00038 vs. TAIR10
Match: AT1G76640.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 41.6 bits (96), Expect = 3.0e-04 Identity = 22/63 (34.92%), Postives = 34/63 (53.97%), Query Frame = 0
BLAST of Carg00038 vs. Swiss-Prot
Match: sp|Q9SRE6|CML38_ARATH (Calcium-binding protein CML38 OS=Arabidopsis thaliana OX=3702 GN=CML38 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.6e-05 Identity = 24/70 (34.29%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of Carg00038 vs. Swiss-Prot
Match: sp|Q0DJV6|CML18_ORYSJ (Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica OX=39947 GN=CML18 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 9.9e-05 Identity = 22/58 (37.93%), Postives = 33/58 (56.90%), Query Frame = 0
BLAST of Carg00038 vs. Swiss-Prot
Match: sp|Q8L3R2|CML41_ARATH (Probable calcium-binding protein CML41 OS=Arabidopsis thaliana OX=3702 GN=CML41 PE=2 SV=2) HSP 1 Score: 45.8 bits (107), Expect = 2.9e-04 Identity = 23/65 (35.38%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Carg00038 vs. Swiss-Prot
Match: sp|Q39419|POLC4_BETPN (Polcalcin Bet v 4 OS=Betula pendula OX=3505 GN=BETV4 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.9e-04 Identity = 24/67 (35.82%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of Carg00038 vs. Swiss-Prot
Match: sp|Q8VWY6|POLC1_TOBAC (Polcalcin Nic t 1 OS=Nicotiana tabacum OX=4097 GN=Nict1 PE=1 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 6.4e-04 Identity = 22/56 (39.29%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of Carg00038 vs. TrEMBL
Match: tr|A0A0A0KZR6|A0A0A0KZR6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G639730 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 1.4e-27 Identity = 62/90 (68.89%), Postives = 76/90 (84.44%), Query Frame = 0
BLAST of Carg00038 vs. TrEMBL
Match: tr|A0A2P4LY04|A0A2P4LY04_QUESU (Calcium-binding allergen ole e 8 OS=Quercus suber OX=58331 GN=CFP56_50060 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.9e-13 Identity = 42/91 (46.15%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of Carg00038 vs. TrEMBL
Match: tr|A0A0A0LRC1|A0A0A0LRC1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G358870 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.3e-12 Identity = 35/77 (45.45%), Postives = 57/77 (74.03%), Query Frame = 0
BLAST of Carg00038 vs. TrEMBL
Match: tr|A0A2P5F8Q2|A0A2P5F8Q2_9ROSA (Parvalbumin OS=Trema orientalis OX=63057 GN=TorRG33x02_099130 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 6.2e-12 Identity = 36/75 (48.00%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of Carg00038 vs. TrEMBL
Match: tr|A0A0A0KMQ1|A0A0A0KMQ1_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G067410 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 1.1e-11 Identity = 31/71 (43.66%), Postives = 53/71 (74.65%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|