Bhi11G001595 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTCTGGACCTTCTTAGAGGGGCTTCTGCTGTTTGCAAATGCCTTTGCAATTCTGAACGAGGATCGTTTTCTTGCTCGGAGAGGATGGACATTAGCAGAGATGTCGAGAGAAAGAAGAAATACACTCAAAGGCCAGGTAATAGGACTCATCCATGCATGCCAATTCTTGAGACTTCCACTCATTCTTTTCAACATCATCATCATCATCATCAAGCTCTTCTCTGGTTGA ATGGGATTCTGGACCTTCTTAGAGGGGCTTCTGCTGTTTGCAAATGCCTTTGCAATTCTGAACGAGGATCGTTTTCTTGCTCGGAGAGGATGGACATTAGCAGAGATGTCGAGAGAAAGAAGAAATACACTCAAAGGCCAGGTAATAGGACTCATCCATGCATGCCAATTCTTGAGACTTCCACTCATTCTTTTCAACATCATCATCATCATCATCAAGCTCTTCTCTGGTTGA ATGGGATTCTGGACCTTCTTAGAGGGGCTTCTGCTGTTTGCAAATGCCTTTGCAATTCTGAACGAGGATCGTTTTCTTGCTCGGAGAGGATGGACATTAGCAGAGATGTCGAGAGAAAGAAGAAATACACTCAAAGGCCAGGTAATAGGACTCATCCATGCATGCCAATTCTTGAGACTTCCACTCATTCTTTTCAACATCATCATCATCATCATCAAGCTCTTCTCTGGTTGA MGFWTFLEGLLLFANAFAILNEDRFLARRGWTLAEMSRERRNTLKGQVIGLIHACQFLRLPLILFNIIIIIIKLFSG
BLAST of Bhi11G001595 vs. Swiss-Prot
Match: sp|O13825|YOS1_SCHPO (Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yos1 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 6.5e-05 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of Bhi11G001595 vs. TAIR10
Match: AT2G37975.1 (Yos1-like protein) HSP 1 Score: 117.9 bits (294), Expect = 2.8e-27 Identity = 57/78 (73.08%), Postives = 70/78 (89.74%), Query Frame = 0
BLAST of Bhi11G001595 vs. TAIR10
Match: AT3G54085.1 (Yos1-like protein) HSP 1 Score: 109.8 bits (273), Expect = 7.7e-25 Identity = 54/78 (69.23%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of Bhi11G001595 vs. TrEMBL
Match: tr|A0A1S3B5S0|A0A1S3B5S0_CUCME (protein transport protein yos1-like OS=Cucumis melo OX=3656 GN=LOC103486333 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.7e-29 Identity = 68/77 (88.31%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of Bhi11G001595 vs. TrEMBL
Match: tr|G7JRA6|G7JRA6_MEDTR (Yos1-like protein OS=Medicago truncatula OX=3880 GN=11414286 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 8.2e-29 Identity = 69/77 (89.61%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of Bhi11G001595 vs. TrEMBL
Match: tr|I3S6H8|I3S6H8_MEDTR (Uncharacterized protein OS=Medicago truncatula OX=3880 PE=2 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 9.1e-28 Identity = 68/77 (88.31%), Postives = 72/77 (93.51%), Query Frame = 0
BLAST of Bhi11G001595 vs. TrEMBL
Match: tr|A0A061EYI1|A0A061EYI1_THECC (Yos1-like protein OS=Theobroma cacao OX=3641 GN=TCM_021785 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.6e-27 Identity = 65/77 (84.42%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of Bhi11G001595 vs. TrEMBL
Match: tr|I1JLU3|I1JLU3_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100818505 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.4e-27 Identity = 65/77 (84.42%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of Bhi11G001595 vs. NCBI nr
Match: XP_022983483.1 (protein transport protein yos1-like [Cucurbita maxima] >XP_022983485.1 protein transport protein yos1-like [Cucurbita maxima]) HSP 1 Score: 145.6 bits (366), Expect = 7.0e-32 Identity = 74/77 (96.10%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of Bhi11G001595 vs. NCBI nr
Match: XP_022934956.1 (protein transport protein yos1-like [Cucurbita moschata] >XP_023527548.1 protein transport protein yos1-like [Cucurbita pepo subsp. pepo] >XP_023527549.1 protein transport protein yos1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 144.1 bits (362), Expect = 2.0e-31 Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of Bhi11G001595 vs. NCBI nr
Match: XP_022145757.1 (protein transport protein yos1-like [Momordica charantia] >XP_022145758.1 protein transport protein yos1-like [Momordica charantia]) HSP 1 Score: 140.6 bits (353), Expect = 2.3e-30 Identity = 71/77 (92.21%), Postives = 74/77 (96.10%), Query Frame = 0
BLAST of Bhi11G001595 vs. NCBI nr
Match: XP_008442479.1 (PREDICTED: protein transport protein yos1-like [Cucumis melo]) HSP 1 Score: 137.1 bits (344), Expect = 2.5e-29 Identity = 68/77 (88.31%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of Bhi11G001595 vs. NCBI nr
Match: XP_004137742.1 (PREDICTED: protein transport protein yos1-like [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 3.3e-29 Identity = 69/77 (89.61%), Postives = 73/77 (94.81%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |