Bhi08G000526 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTAATTCTTCCACTTTCTCCAAATTTCATAACTTTCAAGCCTCTTCTGATCATCTTCCTAACGGAACTTTCAACATTATTGCTATCTCCGCCATCTCTGCCGTCACTGGAGTTTATGAGTTCCCATATTTCCCAATAGAAGATGAAATTCATGTTTTTAAGTGTCATTATTCTCATCATATTATTAATCGTCTTCATTTTTCATTACTACCAATACCGTCTTAGGCTTTACCAAACAAGAATCCTAGATATCGAGCAACGACTCAACTTACACCGTGAAATGCGACTCTTTGCTGGCTTCAGGCCCATATTCTACGGCAACGTCGGGCAGCGGTGCAATCGAACGTGGCCGAGCAGGAAGAAACCTCCTCCACTACCATGACGCTCGCTTACAAAGACACGCTTAAGATGACGGACAAAGTCGGTTCGGACGATTGTTGTGCCATTTGTATTGAAGAGTTTGAAGCGGAAGAGATTTGTGGAGTTATCGAGAATTGTGGCCATTATTTTCATAGGGATTGTATGGATCAGTGGCTGAGGATCGAGAGCCGTTGCCCATTATGTCGTTGTTTGGTTCATCTTGTAGCTCATAATAATAATTCCCAAGAAAATCAAGCTTAG ATGTTTAATTCTTCCACTTTCTCCAAATTTCATAACTTTCAAGCCTCTTCTGATCATCTTCCTAACGGAACTTTCAACATTATTGCTATCTCCGCCATCTCTGCCGTCACTGGAGTTTATGAGTTCCCATATTTCCCAATAGAAGATGAAATTCATGCCCATATTCTACGGCAACGTCGGGCAGCGGTGCAATCGAACGTGGCCGAGCAGGAAGAAACCTCCTCCACTACCATGACGCTCGCTTACAAAGACACGCTTAAGATGACGGACAAAGTCGGTTCGGACGATTGTTGTGCCATTTGTATTGAAGAGTTTGAAGCGGAAGAGATTTGTGGAGTTATCGAGAATTGTGGCCATTATTTTCATAGGGATTGTATGGATCAGTGGCTGAGGATCGAGAGCCGTTGCCCATTATGTCGTTGTTTGGTTCATCTTGTAGCTCATAATAATAATTCCCAAGAAAATCAAGCTTAG ATGTTTAATTCTTCCACTTTCTCCAAATTTCATAACTTTCAAGCCTCTTCTGATCATCTTCCTAACGGAACTTTCAACATTATTGCTATCTCCGCCATCTCTGCCGTCACTGGAGTTTATGAGTTCCCATATTTCCCAATAGAAGATGAAATTCATGCCCATATTCTACGGCAACGTCGGGCAGCGGTGCAATCGAACGTGGCCGAGCAGGAAGAAACCTCCTCCACTACCATGACGCTCGCTTACAAAGACACGCTTAAGATGACGGACAAAGTCGGTTCGGACGATTGTTGTGCCATTTGTATTGAAGAGTTTGAAGCGGAAGAGATTTGTGGAGTTATCGAGAATTGTGGCCATTATTTTCATAGGGATTGTATGGATCAGTGGCTGAGGATCGAGAGCCGTTGCCCATTATGTCGTTGTTTGGTTCATCTTGTAGCTCATAATAATAATTCCCAAGAAAATCAAGCTTAG MFNSSTFSKFHNFQASSDHLPNGTFNIIAISAISAVTGVYEFPYFPIEDEIHAHILRQRRAAVQSNVAEQEETSSTTMTLAYKDTLKMTDKVGSDDCCAICIEEFEAEEICGVIENCGHYFHRDCMDQWLRIESRCPLCRCLVHLVAHNNNSQENQA
BLAST of Bhi08G000526 vs. Swiss-Prot
Match: sp|Q9LSW9|ATL16_ARATH (RING-H2 finger protein ATL16 OS=Arabidopsis thaliana OX=3702 GN=ATL16 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 8.9e-09 Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of Bhi08G000526 vs. Swiss-Prot
Match: sp|Q9P7E1|YOF7_SCHPO (Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP4H10.07 PE=1 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 8.9e-09 Identity = 22/49 (44.90%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of Bhi08G000526 vs. Swiss-Prot
Match: sp|Q9LZJ6|ATL5_ARATH (RING-H2 finger protein ATL5 OS=Arabidopsis thaliana OX=3702 GN=ATL5 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.2e-08 Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of Bhi08G000526 vs. Swiss-Prot
Match: sp|O22255|ATL64_ARATH (RING-H2 finger protein ATL64 OS=Arabidopsis thaliana OX=3702 GN=ATL64 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.5e-08 Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of Bhi08G000526 vs. Swiss-Prot
Match: sp|Q8AWW4|RN128_XENLA (E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis OX=8355 GN=rnf128 PE=2 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 2.0e-08 Identity = 25/59 (42.37%), Postives = 39/59 (66.10%), Query Frame = 0
BLAST of Bhi08G000526 vs. TAIR10
Match: AT5G43420.1 (RING/U-box superfamily protein) HSP 1 Score: 61.6 bits (148), Expect = 4.9e-10 Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of Bhi08G000526 vs. TAIR10
Match: AT3G62690.1 (AtL5) HSP 1 Score: 61.2 bits (147), Expect = 6.4e-10 Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of Bhi08G000526 vs. TAIR10
Match: AT5G53110.1 (RING/U-box superfamily protein) HSP 1 Score: 61.2 bits (147), Expect = 6.4e-10 Identity = 22/46 (47.83%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of Bhi08G000526 vs. TAIR10
Match: AT2G47560.1 (RING/U-box superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 8.4e-10 Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of Bhi08G000526 vs. TAIR10
Match: AT3G47990.1 (SUGAR-INSENSITIVE 3) HSP 1 Score: 59.7 bits (143), Expect = 1.9e-09 Identity = 28/56 (50.00%), Postives = 35/56 (62.50%), Query Frame = 0
BLAST of Bhi08G000526 vs. TrEMBL
Match: tr|A0A1S4E1K2|A0A1S4E1K2_CUCME (RING-H2 finger protein ATL52-like OS=Cucumis melo OX=3656 GN=LOC107991538 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 4.0e-22 Identity = 57/99 (57.58%), Postives = 66/99 (66.67%), Query Frame = 0
BLAST of Bhi08G000526 vs. TrEMBL
Match: tr|A0A0L9U2K0|A0A0L9U2K0_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan03g042900 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 2.1e-10 Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = 0
BLAST of Bhi08G000526 vs. TrEMBL
Match: tr|A0A1S3TSW9|A0A1S3TSW9_VIGRR (RING-H2 finger protein ATL32-like OS=Vigna radiata var. radiata OX=3916 GN=LOC106758423 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 7.8e-10 Identity = 29/57 (50.88%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of Bhi08G000526 vs. TrEMBL
Match: tr|V7B4G9|V7B4G9_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_008G057100g PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 7.8e-10 Identity = 29/74 (39.19%), Postives = 43/74 (58.11%), Query Frame = 0
BLAST of Bhi08G000526 vs. TrEMBL
Match: tr|A0A0D2PJZ0|A0A0D2PJZ0_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_007G363500 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.0e-09 Identity = 28/70 (40.00%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of Bhi08G000526 vs. NCBI nr
Match: XP_023520574.1 (RING-H2 finger protein ATL64-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 119.4 bits (298), Expect = 1.1e-23 Identity = 55/87 (63.22%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of Bhi08G000526 vs. NCBI nr
Match: XP_022970384.1 (RING-H2 finger protein ATL64-like [Cucurbita maxima]) HSP 1 Score: 114.8 bits (286), Expect = 2.7e-22 Identity = 56/104 (53.85%), Postives = 74/104 (71.15%), Query Frame = 0
BLAST of Bhi08G000526 vs. NCBI nr
Match: XP_016902103.1 (PREDICTED: RING-H2 finger protein ATL52-like [Cucumis melo]) HSP 1 Score: 113.6 bits (283), Expect = 6.0e-22 Identity = 57/99 (57.58%), Postives = 66/99 (66.67%), Query Frame = 0
BLAST of Bhi08G000526 vs. NCBI nr
Match: XP_022964751.1 (RING-H2 finger protein ATL64-like [Cucurbita moschata]) HSP 1 Score: 109.8 bits (273), Expect = 8.7e-21 Identity = 47/73 (64.38%), Postives = 59/73 (80.82%), Query Frame = 0
BLAST of Bhi08G000526 vs. NCBI nr
Match: XP_022158249.1 (E3 ubiquitin-protein ligase RING1-like [Momordica charantia]) HSP 1 Score: 95.9 bits (237), Expect = 1.3e-16 Identity = 48/105 (45.71%), Postives = 66/105 (62.86%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |