Bhi05G000177 (gene) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCATAATTCTTTTGCTTTCTGCACAAACTGAAGGCATGAGACCATTGAAAGAACAGCAATGGCCGAAGTTAATTTCTCAGTCACTACAACGGGCGCCAGTGCCGCCGTCGGGGCCGAACCCTTGTACCAATATTCCCGGAAACGGGAACGTTCCTTGTGAGTTGGCCGGCATGAATGTCGTCGGTGCCGCTCTCCGCCAACCATCTTCTCTGCCGCTACCGCCACCACCGTCTTTTGCTCCCTTGTCTGGATGA ATGTTCATAATTCTTTTGCTTTCTGCACAAACTGAAGGCATGAGACCATTGAAAGAACAGCAATGGCCGAAGTTAATTTCTCAGTCACTACAACGGGCGCCAGTGCCGCCGTCGGGGCCGAACCCTTGTACCAATATTCCCGGAAACGGGAACGTTCCTTGTGAGTTGGCCGGCATGAATGTCGTCGGTGCCGCTCTCCGCCAACCATCTTCTCTGCCGCTACCGCCACCACCGTCTTTTGCTCCCTTGTCTGGATGA ATGTTCATAATTCTTTTGCTTTCTGCACAAACTGAAGGCATGAGACCATTGAAAGAACAGCAATGGCCGAAGTTAATTTCTCAGTCACTACAACGGGCGCCAGTGCCGCCGTCGGGGCCGAACCCTTGTACCAATATTCCCGGAAACGGGAACGTTCCTTGTGAGTTGGCCGGCATGAATGTCGTCGGTGCCGCTCTCCGCCAACCATCTTCTCTGCCGCTACCGCCACCACCGTCTTTTGCTCCCTTGTCTGGATGA MFIILLLSAQTEGMRPLKEQQWPKLISQSLQRAPVPPSGPNPCTNIPGNGNVPCELAGMNVVGAALRQPSSLPLPPPPSFAPLSG
BLAST of Bhi05G000177 vs. TAIR10
Match: AT1G06137.1 (unknown protein) HSP 1 Score: 44.7 bits (104), Expect = 3.4e-05 Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 0
BLAST of Bhi05G000177 vs. TAIR10
Match: AT1G06135.1 (unknown protein) HSP 1 Score: 40.0 bits (92), Expect = 8.3e-04 Identity = 22/47 (46.81%), Postives = 27/47 (57.45%), Query Frame = 0
BLAST of Bhi05G000177 vs. TAIR10
Match: AT2G31345.1 (unknown protein) HSP 1 Score: 40.0 bits (92), Expect = 8.3e-04 Identity = 24/51 (47.06%), Postives = 32/51 (62.75%), Query Frame = 0
BLAST of Bhi05G000177 vs. TrEMBL
Match: tr|A0A2P5VRW0|A0A2P5VRW0_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA39159 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 4.4e-07 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of Bhi05G000177 vs. TrEMBL
Match: tr|A0A1U8L9L4|A0A1U8L9L4_GOSHI (uncharacterized protein LOC107924233 OS=Gossypium hirsutum OX=3635 GN=LOC107924233 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 4.4e-07 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of Bhi05G000177 vs. TrEMBL
Match: tr|A0A0D2SB73|A0A0D2SB73_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_007G143900 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 4.4e-07 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of Bhi05G000177 vs. TrEMBL
Match: tr|A0A2P5SET0|A0A2P5SET0_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD05429 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 4.4e-07 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of Bhi05G000177 vs. TrEMBL
Match: tr|A0A0D2QTD9|A0A0D2QTD9_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_004G073800 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 2.2e-06 Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of Bhi05G000177 vs. NCBI nr
Match: XP_022771230.1 (uncharacterized protein LOC111314297 [Durio zibethinus]) HSP 1 Score: 63.5 bits (153), Expect = 3.9e-07 Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Bhi05G000177 vs. NCBI nr
Match: XP_012490670.1 (PREDICTED: uncharacterized protein LOC105803178 [Gossypium raimondii] >XP_016710068.1 PREDICTED: uncharacterized protein LOC107924233 [Gossypium hirsutum] >KJB39056.1 hypothetical protein B456_007G143900 [Gossypium raimondii] >PPD97533.1 hypothetical protein GOBAR_DD05429 [Gossypium barbadense]) HSP 1 Score: 62.8 bits (151), Expect = 6.6e-07 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of Bhi05G000177 vs. NCBI nr
Match: PPR81557.1 (hypothetical protein GOBAR_AA39159 [Gossypium barbadense] >PPR81558.1 hypothetical protein GOBAR_AA39160 [Gossypium barbadense]) HSP 1 Score: 62.8 bits (151), Expect = 6.6e-07 Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of Bhi05G000177 vs. NCBI nr
Match: XP_021888699.1 (uncharacterized protein LOC110807772 [Carica papaya]) HSP 1 Score: 62.0 bits (149), Expect = 1.1e-06 Identity = 34/73 (46.58%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Bhi05G000177 vs. NCBI nr
Match: KJB22919.1 (hypothetical protein B456_004G073800 [Gossypium raimondii]) HSP 1 Score: 60.5 bits (145), Expect = 3.3e-06 Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |