MELO3C008633 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAAGAGAGAAAAAGAGAGGAAGGAGAAAGAAGAGGAAGAGAAAGCGAGAAGAGAAAGAAATAGAAGAAGAAAAGGAAGAAAGGAAAAGGCAAAAGAAAAGAGAGAAACAAGGCAAGAAAGATCAAGAAACAATTTCCTTGCTTATTTCCCCAAAAGAATTCAAGAAGTTTGCGAAGAAAGCTGAAGAGAAGCACGAGAAAGTTAAATAA ATGCAAAGAGAGAAAAAGAGAGGAAGGAGAAAGAAGAGGAAGAGAAAGCGAGAAGAGAAAGAAATAGAAGAAGAAAAGGAAGAAAGGAAAAGGCAAAAGAAAAGAGAGAAACAAGGCAAGAAAGATCAAGAAACAATTTCCTTGCTTATTTCCCCAAAAGAATTCAAGAAGTTTGCGAAGAAAGCTGAAGAGAAGCACGAGAAAGTTAAATAA ATGCAAAGAGAGAAAAAGAGAGGAAGGAGAAAGAAGAGGAAGAGAAAGCGAGAAGAGAAAGAAATAGAAGAAGAAAAGGAAGAAAGGAAAAGGCAAAAGAAAAGAGAGAAACAAGGCAAGAAAGATCAAGAAACAATTTCCTTGCTTATTTCCCCAAAAGAATTCAAGAAGTTTGCGAAGAAAGCTGAAGAGAAGCACGAGAAAGTTAAATAA MQREKKRGRRKKRKRKREEKEIEEEKEERKRQKKREKQGKKDQETISLLISPKEFKKFAKKAEEKHEKVK*
BLAST of MELO3C008633 vs. Swiss-Prot
Match: Y5G8_ENCCU (UPF0329 protein ECU05_1680/ECU11_0050 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_1680 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.8e-06 Identity = 27/71 (38.03%), Postives = 45/71 (63.38%), Query Frame = 1
HSP 2 Score: 43.5 bits (101), Expect = 1.1e-03 Identity = 17/43 (39.53%), Postives = 32/43 (74.42%), Query Frame = 1
BLAST of MELO3C008633 vs. TrEMBL
Match: A0A158PKC6_ANGCS (Uncharacterized protein OS=Angiostrongylus costaricensis PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.5e-07 Identity = 34/70 (48.57%), Postives = 49/70 (70.00%), Query Frame = 1
BLAST of MELO3C008633 vs. TrEMBL
Match: A0A158PKC6_ANGCS (Uncharacterized protein OS=Angiostrongylus costaricensis PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.4e-05 Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 1
HSP 2 Score: 52.8 bits (125), Expect = 2.0e-04 Identity = 32/69 (46.38%), Postives = 44/69 (63.77%), Query Frame = 1
HSP 3 Score: 48.1 bits (113), Expect = 5.0e-03 Identity = 30/68 (44.12%), Postives = 41/68 (60.29%), Query Frame = 1
HSP 4 Score: 47.0 bits (110), Expect = 1.1e-02 Identity = 24/68 (35.29%), Postives = 46/68 (67.65%), Query Frame = 1
HSP 5 Score: 47.0 bits (110), Expect = 1.1e-02 Identity = 26/68 (38.24%), Postives = 44/68 (64.71%), Query Frame = 1
HSP 6 Score: 57.8 bits (138), Expect = 6.4e-06 Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of MELO3C008633 vs. TrEMBL
Match: A0A0L8I3P4_OCTBM (Uncharacterized protein (Fragment) OS=Octopus bimaculoides GN=OCBIM_22036271mg PE=4 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.5e-04 Identity = 24/69 (34.78%), Postives = 47/69 (68.12%), Query Frame = 1
HSP 2 Score: 45.4 bits (106), Expect = 3.3e-02 Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 1
HSP 3 Score: 41.6 bits (96), Expect = 4.7e-01 Identity = 22/53 (41.51%), Postives = 34/53 (64.15%), Query Frame = 1
HSP 4 Score: 30.0 bits (66), Expect = 1.4e+03 Identity = 18/58 (31.03%), Postives = 33/58 (56.90%), Query Frame = 1
BLAST of MELO3C008633 vs. NCBI nr
Match: gi|944207621|gb|KQK74690.1| (hypothetical protein AAES_154774 [Amazona aestiva]) HSP 1 Score: 58.2 bits (139), Expect = 7.0e-06 Identity = 27/68 (39.71%), Postives = 50/68 (73.53%), Query Frame = 1
BLAST of MELO3C008633 vs. NCBI nr
Match: gi|918333261|gb|KOF96117.1| (hypothetical protein OCBIM_22036271mg, partial [Octopus bimaculoides]) HSP 1 Score: 57.8 bits (138), Expect = 9.1e-06 Identity = 31/71 (43.66%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of MELO3C008633 vs. NCBI nr
Match: gi|918333261|gb|KOF96117.1| (hypothetical protein OCBIM_22036271mg, partial [Octopus bimaculoides]) HSP 1 Score: 52.0 bits (123), Expect = 5.0e-04 Identity = 24/69 (34.78%), Postives = 47/69 (68.12%), Query Frame = 1
HSP 2 Score: 45.4 bits (106), Expect = 4.7e-02 Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 1
HSP 3 Score: 41.6 bits (96), Expect = 6.8e-01 Identity = 22/53 (41.51%), Postives = 34/53 (64.15%), Query Frame = 1
HSP 4 Score: 30.0 bits (66), Expect = 2.0e+03 Identity = 18/58 (31.03%), Postives = 33/58 (56.90%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|