MELO3C019445 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCCCGCCCAACGCTCCTTCGTTCAGAAGCAATGGAGCAAAGATGAAATTAATATAATTTCCGCTACAGTGGCTTTTGGAATGGTGGGTATAACTGATCATTGCTTGTTGAAATATGAATTTGTATAGAAATAACAATCAACTATGCACTTATTTGGATATTTCAGGCATCAACAAGCCAAATGTTCGGTTTGTCATTCACCATTCTCTTCCAAAAAGTACCATCAGGTAATTAATTGTATACTGCTTCATTTAGTTGGTATTGTCCATGTAATAATAGTCTTCATTCAAAATATTTTTAATTCATCTTGAGAACATAAAAACTACAATTGGTCTTTGTTTTACCTCCCCCCCTCACCCCCATTTGTCTTTTACCAAAATAAACAGTGCTCATAGAGCTGCTGGATTATCGATAAAATTGTTTCTTATTATAATGTTCTTGGCTTTCGGTGTGTTTCTAATGTTTTAGGAGTGTGGCCGTGCAGGCAGAGATGGTATGCCTTCATCCCGTGTGTTATATTATAGTTACAGTGATTATGTAAGTTAAGTGATCATGGACTAACGTCTTACATTATCTAGCTGTAAAGGGTATAATATTACATTCACAAGGTTCTTGAAAAGTGGTTTGGATTCTAGTATCCATTGCTTATTGCTTACTGGCTCTTAAACTGATGAGTGGAGGCAAATTTAATATAATATCTAATGCCTATGTTTGTCAAAACTTCTTGAACATGTATGCAGATACGAGTCAAGCATATGATTAGCCAAGGAGCCACTGAGCAAAGTCCTCTCGTATCTGGATATAATTGTACCAATCTGGGCAGCTCTAGAAGGATACTAAAAGACCAACACTGA ATGGATCCCGCCCAACGCTCCTTCGTTCAGAAGCAATGGAGCAAAGATGAAATTAATATAATTTCCGCTACAGTGGCTTTTGGAATGGTGGGCATCAACAAGCCAAATGTTCGGTTTGTCATTCACCATTCTCTTCCAAAAAGTACCATCAGGAGTGTGGCCGTGCAGGCAGAGATGATACGAGTCAAGCATATGATTAGCCAAGGAGCCACTGAGCAAAGTCCTCTCGTATCTGGATATAATTGTACCAATCTGGGCAGCTCTAGAAGGATACTAAAAGACCAACACTGA ATGGATCCCGCCCAACGCTCCTTCGTTCAGAAGCAATGGAGCAAAGATGAAATTAATATAATTTCCGCTACAGTGGCTTTTGGAATGGTGGGCATCAACAAGCCAAATGTTCGGTTTGTCATTCACCATTCTCTTCCAAAAAGTACCATCAGGAGTGTGGCCGTGCAGGCAGAGATGATACGAGTCAAGCATATGATTAGCCAAGGAGCCACTGAGCAAAGTCCTCTCGTATCTGGATATAATTGTACCAATCTGGGCAGCTCTAGAAGGATACTAAAAGACCAACACTGA MDPAQRSFVQKQWSKDEINIISATVAFGMVGINKPNVRFVIHHSLPKSTIRSVAVQAEMIRVKHMISQGATEQSPLVSGYNCTNLGSSRRILKDQH*
BLAST of MELO3C019445 vs. Swiss-Prot
Match: RQL4A_ARATH (ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana GN=RECQL4A PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.6e-23 Identity = 63/111 (56.76%), Postives = 72/111 (64.86%), Query Frame = 1
BLAST of MELO3C019445 vs. Swiss-Prot
Match: RQL4B_ARATH (ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana GN=RECQL4B PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.6e-22 Identity = 64/111 (57.66%), Postives = 69/111 (62.16%), Query Frame = 1
BLAST of MELO3C019445 vs. Swiss-Prot
Match: RECQ1_CAEBR (Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis briggsae GN=CBG24191 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 31/48 (64.58%), Postives = 35/48 (72.92%), Query Frame = 1
BLAST of MELO3C019445 vs. Swiss-Prot
Match: RECQ1_CAEEL (Putative ATP-dependent DNA helicase Q1 OS=Caenorhabditis elegans GN=K02F3.12 PE=3 SV=3) HSP 1 Score: 62.8 bits (151), Expect = 2.4e-09 Identity = 31/48 (64.58%), Postives = 34/48 (70.83%), Query Frame = 1
BLAST of MELO3C019445 vs. Swiss-Prot
Match: RECQ1_HUMAN (ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3) HSP 1 Score: 62.4 bits (150), Expect = 3.2e-09 Identity = 38/115 (33.04%), Postives = 60/115 (52.17%), Query Frame = 1
BLAST of MELO3C019445 vs. TrEMBL
Match: A0A0A0L762_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G221760 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.1e-29 Identity = 78/111 (70.27%), Postives = 84/111 (75.68%), Query Frame = 1
BLAST of MELO3C019445 vs. TrEMBL
Match: M5WMH6_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000416mg PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-25 Identity = 71/111 (63.96%), Postives = 78/111 (70.27%), Query Frame = 1
BLAST of MELO3C019445 vs. TrEMBL
Match: A0A0L9VHB1_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan09g273300 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 65/93 (69.89%), Postives = 73/93 (78.49%), Query Frame = 1
BLAST of MELO3C019445 vs. TrEMBL
Match: F6HK69_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0035g00400 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 3.2e-24 Identity = 69/111 (62.16%), Postives = 78/111 (70.27%), Query Frame = 1
BLAST of MELO3C019445 vs. TrEMBL
Match: A0A151T850_CAJCA (ATP-dependent DNA helicase hus2/rqh1 OS=Cajanus cajan GN=KK1_017751 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 3.2e-24 Identity = 68/111 (61.26%), Postives = 79/111 (71.17%), Query Frame = 1
BLAST of MELO3C019445 vs. TAIR10
Match: AT1G10930.1 (AT1G10930.1 DNA helicase (RECQl4A)) HSP 1 Score: 107.5 bits (267), Expect = 4.8e-24 Identity = 63/111 (56.76%), Postives = 72/111 (64.86%), Query Frame = 1
BLAST of MELO3C019445 vs. TAIR10
Match: AT1G60930.1 (AT1G60930.1 RECQ helicase L4B) HSP 1 Score: 104.8 bits (260), Expect = 3.1e-23 Identity = 64/111 (57.66%), Postives = 69/111 (62.16%), Query Frame = 1
BLAST of MELO3C019445 vs. TAIR10
Match: AT1G31360.1 (AT1G31360.1 RECQ helicase L2) HSP 1 Score: 60.5 bits (145), Expect = 6.8e-10 Identity = 30/48 (62.50%), Postives = 34/48 (70.83%), Query Frame = 1
BLAST of MELO3C019445 vs. TAIR10
Match: AT3G05740.1 (AT3G05740.1 RECQ helicase l1) HSP 1 Score: 50.4 bits (119), Expect = 7.0e-07 Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 1
BLAST of MELO3C019445 vs. NCBI nr
Match: gi|659112096|ref|XP_008456063.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4B isoform X1 [Cucumis melo]) HSP 1 Score: 154.1 bits (388), Expect = 1.3e-34 Identity = 84/110 (76.36%), Postives = 87/110 (79.09%), Query Frame = 1
BLAST of MELO3C019445 vs. NCBI nr
Match: gi|659112098|ref|XP_008456064.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X2 [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 3.1e-33 Identity = 81/97 (83.51%), Postives = 85/97 (87.63%), Query Frame = 1
BLAST of MELO3C019445 vs. NCBI nr
Match: gi|659112086|ref|XP_008456059.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X2 [Cucumis melo]) HSP 1 Score: 138.7 bits (348), Expect = 5.6e-30 Identity = 75/93 (80.65%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of MELO3C019445 vs. NCBI nr
Match: gi|778680266|ref|XP_011651280.1| (PREDICTED: ATP-dependent DNA helicase Q-like 4A isoform X1 [Cucumis sativus]) HSP 1 Score: 137.1 bits (344), Expect = 1.6e-29 Identity = 78/111 (70.27%), Postives = 84/111 (75.68%), Query Frame = 1
BLAST of MELO3C019445 vs. NCBI nr
Match: gi|700202460|gb|KGN57593.1| (hypothetical protein Csa_3G221760 [Cucumis sativus]) HSP 1 Score: 137.1 bits (344), Expect = 1.6e-29 Identity = 78/111 (70.27%), Postives = 84/111 (75.68%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|