MELO3C008570T1 (mRNA) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCCTCCGCCGTTGAAAAAACCCTTACCGGCATCAGAAACCTAATTCGTCTCCTCCCCACCGGCACCGTCTTTCTTTTCCAATTCCTCAGTCCAATCCTCACCAACAGCGGCTACCGCGAACCAATCAACAAAAAAGGCAGAGAGATAAAGAAGAAGAACAAAACGTTGTACTCGTTCTTCCTTGGGCGAAAGAAAATAGTGTAG ATGGCTGCCTCCGCCGTTGAAAAAACCCTTACCGGCATCAGAAACCTAATTCGTCTCCTCCCCACCGGCACCGTCTTTCTTTTCCAATTCCTCAGTCCAATCCTCACCAACAGCGGCTACCGCGAACCAATCAACAAAAAAGGCAGAGAGATAAAGAAGAAGAACAAAACGTTGTACTCGTTCTTCCTTGGGCGAAAGAAAATAGTGTAG ATGGCTGCCTCCGCCGTTGAAAAAACCCTTACCGGCATCAGAAACCTAATTCGTCTCCTCCCCACCGGCACCGTCTTTCTTTTCCAATTCCTCAGTCCAATCCTCACCAACAGCGGCTACCGCGAACCAATCAACAAAAAAGGCAGAGAGATAAAGAAGAAGAACAAAACGTTGTACTCGTTCTTCCTTGGGCGAAAGAAAATAGTGTAG MAASAVEKTLTGIRNLIRLLPTGTVFLFQFLSPILTNSGYREPINKKGREIKKKNKTLYSFFLGRKKIV*
BLAST of MELO3C008570T1 vs. TrEMBL
Match: A0A0A0LAH2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G150800 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.0e-11 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 1
BLAST of MELO3C008570T1 vs. TrEMBL
Match: A0A0A0L536_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G150790 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.3e-08 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 1
BLAST of MELO3C008570T1 vs. TrEMBL
Match: A0A0A0L7S6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G150780 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.9e-08 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 1
BLAST of MELO3C008570T1 vs. TrEMBL
Match: F6HDJ4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g02280 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.5e-07 Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 1
BLAST of MELO3C008570T1 vs. TrEMBL
Match: A0A0D2NYM0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G256300 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.3e-07 Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = 1
BLAST of MELO3C008570T1 vs. TAIR10
Match: AT3G21550.1 (AT3G21550.1 DUF679 domain membrane protein 2) HSP 1 Score: 56.2 bits (134), Expect = 9.2e-09 Identity = 25/40 (62.50%), Postives = 33/40 (82.50%), Query Frame = 1
BLAST of MELO3C008570T1 vs. TAIR10
Match: AT3G21520.1 (AT3G21520.1 DUF679 domain membrane protein 1) HSP 1 Score: 47.8 bits (112), Expect = 3.3e-06 Identity = 21/39 (53.85%), Postives = 28/39 (71.79%), Query Frame = 1
BLAST of MELO3C008570T1 vs. NCBI nr
Match: gi|659076592|ref|XP_008438763.1| (PREDICTED: uncharacterized protein LOC103483776 [Cucumis melo]) HSP 1 Score: 81.3 bits (199), Expect = 7.6e-13 Identity = 40/46 (86.96%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of MELO3C008570T1 vs. NCBI nr
Match: gi|778688486|ref|XP_004134465.2| (PREDICTED: uncharacterized protein LOC101205641 [Cucumis sativus]) HSP 1 Score: 77.0 bits (188), Expect = 1.4e-11 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 1
BLAST of MELO3C008570T1 vs. NCBI nr
Match: gi|700201918|gb|KGN57051.1| (hypothetical protein Csa_3G150800 [Cucumis sativus]) HSP 1 Score: 77.0 bits (188), Expect = 1.4e-11 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 1
BLAST of MELO3C008570T1 vs. NCBI nr
Match: gi|449433357|ref|XP_004134464.1| (PREDICTED: uncharacterized protein LOC101205404 [Cucumis sativus]) HSP 1 Score: 66.6 bits (161), Expect = 1.9e-08 Identity = 33/47 (70.21%), Postives = 40/47 (85.11%), Query Frame = 1
BLAST of MELO3C008570T1 vs. NCBI nr
Match: gi|659076586|ref|XP_008438760.1| (PREDICTED: uncharacterized protein LOC103483773 [Cucumis melo]) HSP 1 Score: 65.9 bits (159), Expect = 3.3e-08 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
|